Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.47
PubTator Score 10.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Rubella 14 3.731 1.9
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.078 0.002

Synonym

Accession Q9NY93 A4D2K9 C9JV95 Q6IAE2 Q9H9I8
Symbols DDX21
DDX26
NOH61

Gene

Gene RIF (4)

PMID Text
23608157 DDX56 interacts with HIV-1 Rev and enhances the Rev function. DDX56 alters the subcellular localization of Rev from nucleolus to nucleus and co-localizes with Rev in the nucleus
22925334 The helicase activity of DDX56 is required for its role in assembly of infectious West Nile virus particles.
21411523 Coimmunoprecipitation confirmed that capsid protein binds to human DDX56 in infected cells and that this interaction is required for assembly of infectious West Nile virus particles.
11593297 DDX26 maps to7p12, a region of frequent chromosome amplifications in glioblastoma involving the EGFR gene.

AA Sequence

MEDSEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLL      1 - 70
HRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVG     71 - 140
TPSRILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKEL    141 - 210
ILHNPVTLKLQESQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKSLLFVNTLERSYRLRLFLEQ    211 - 280
FSIPTCVLNGELPLRSRCHIISQFNQGFYDCVIATDAEVLGAPVKGKRRGRGPKGDKASDPEAGVARGID    281 - 350
FHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEELLSGENRGPILLPYQFRM    351 - 420
EEIEGFRYRCRDAMRSVTKQAIREARLKEIKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLG    421 - 490
HVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS                 491 - 547
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22925334 2012 The helicase activity of DDX56 is required for its role in assembly of infectious West Nile virus particles.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21411523 2011 The capsid-binding nucleolar helicase DDX56 is important for infectivity of West Nile virus.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...