Property Summary

NCBI Gene PubMed Count 12
Grant Count 15
R01 Count 11
Funding $1,077,345.67
PubMed Score 440.77
PubTator Score 21.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.500 0.000
non-small cell lung carcinoma -1.500 0.000

Gene RIF (8)

PMID Text
25200297 Data suggest SGLT3 in neurons of portal vein wall plays role in sensing blood glucose level and in satiety response; dietary protein indirectly affects satiety response via up-regulation of intestinal gluconeogenesis and thus blood glucose. [REVIEW]
22766068 the expression and functional role of SGLT3 in the human kidney
20421923 hSGLT3 functions as a sugar sensor in vivo and mutating a single amino acid converts this sugar sensor into a sugar transporter similar to SGLT1.
18198291 Suggest SGLT3 may be a possible candidate for changes in membrane potential of skeletal muscle during periods of glucose-supplemented exercise.
17705872 Meta-analysis of gene-disease association. (HuGE Navigator)
17110502 substrate specificity study of imino sugars with hSGLT3; results for hSGLT3 are compared with those for alpha-glucosidases and human SGLT type 1
16319503 Observational study of gene-disease association. (HuGE Navigator)
13130073 determination that SGLT3 is not a Na+/glucose cotransporter but instead a glucose sensor in the plasma membrane of cholinergic neurons, skeletal muscle, and other tissues

AA Sequence

MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPM      1 - 70
GASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGER     71 - 140
LQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTII    141 - 210
MLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGII    211 - 280
FGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSE    281 - 350
CVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK    351 - 420
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLM    421 - 490
VGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLC    491 - 560
WVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDT    561 - 630
SERPSWRTIVNINAILLLAVVVFIHGYYA                                             631 - 659
//

Text Mined References (12)

PMID Year Title
25200297 2014 Metabolic effects of portal vein sensing.
22766068 2012 A novel SGLT is expressed in the human kidney.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20421923 2010 A single amino acid change converts the sugar sensor SGLT3 into a sugar transporter.
18198291 2008 Protection of muscle membrane excitability during cycling in humans: a role for SGLT3?
17705872 2007 Lack of association between the Serotonin Transporter Promoter Polymorphism (5-HTTLPR) and Panic Disorder: a systematic review and meta-analysis.
17110502 2007 Imino sugars are potent agonists of the human glucose sensor SGLT3.
16319503 2006 Neuroticism mediates the association of the serotonin transporter gene with lifetime major depression.
13130073 2003 A glucose sensor hiding in a family of transporters.
12354616 2002 The sodium/substrate symporter family: structural and functional features.
More...