Property Summary

NCBI Gene PubMed Count 12
PubMed Score 440.77
PubTator Score 21.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.500 0.000
non-small cell lung carcinoma -1.500 0.000

Synonym

Accession Q9NY91 O15279
Symbols SAAT1
SGLT3
DJ90G24.4

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG

 GWAS Trait (1)

Gene RIF (8)

PMID Text
25200297 Data suggest SGLT3 in neurons of portal vein wall plays role in sensing blood glucose level and in satiety response; dietary protein indirectly affects satiety response via up-regulation of intestinal gluconeogenesis and thus blood glucose. [REVIEW]
22766068 the expression and functional role of SGLT3 in the human kidney
20421923 hSGLT3 functions as a sugar sensor in vivo and mutating a single amino acid converts this sugar sensor into a sugar transporter similar to SGLT1.
18198291 Suggest SGLT3 may be a possible candidate for changes in membrane potential of skeletal muscle during periods of glucose-supplemented exercise.
17705872 Meta-analysis of gene-disease association. (HuGE Navigator)
17110502 substrate specificity study of imino sugars with hSGLT3; results for hSGLT3 are compared with those for alpha-glucosidases and human SGLT type 1
16319503 Observational study of gene-disease association. (HuGE Navigator)
13130073 determination that SGLT3 is not a Na+/glucose cotransporter but instead a glucose sensor in the plasma membrane of cholinergic neurons, skeletal muscle, and other tissues

AA Sequence

MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPM      1 - 70
GASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGER     71 - 140
LQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTII    141 - 210
MLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGII    211 - 280
FGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSE    281 - 350
CVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK    351 - 420
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLM    421 - 490
VGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLC    491 - 560
WVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDT    561 - 630
SERPSWRTIVNINAILLLAVVVFIHGYYA                                             631 - 659
//

Text Mined References (12)

PMID Year Title
25200297 2014 Metabolic effects of portal vein sensing.
22766068 2012 A novel SGLT is expressed in the human kidney.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20421923 2010 A single amino acid change converts the sugar sensor SGLT3 into a sugar transporter.
18198291 2008 Protection of muscle membrane excitability during cycling in humans: a role for SGLT3?
17705872 2007 Lack of association between the Serotonin Transporter Promoter Polymorphism (5-HTTLPR) and Panic Disorder: a systematic review and meta-analysis.
17110502 2007 Imino sugars are potent agonists of the human glucose sensor SGLT3.
16319503 2006 Neuroticism mediates the association of the serotonin transporter gene with lifetime major depression.
13130073 2003 A glucose sensor hiding in a family of transporters.
12354616 2002 The sodium/substrate symporter family: structural and functional features.
More...