Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.26
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVKRTSPEELVND      1 - 70
HARENRINPLQMEEEEFMEIMVEIPAK                                                71 - 97
//

Text Mined References (16)

PMID Year Title