Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.66
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.000 1.9e-08
cutaneous lupus erythematosus 2.000 1.7e-02
cystic fibrosis 1.200 4.6e-03
lung cancer -2.000 1.6e-02
lung carcinoma -1.600 5.7e-07
mucosa-associated lymphoid tissue lympho... 1.139 4.5e-02
nasopharyngeal carcinoma -1.400 3.8e-07
osteosarcoma -3.220 1.7e-06

Gene RIF (1)

AA Sequence

MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAK      1 - 70
QGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANI     71 - 140
GDKKPCNASDSQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIF    141 - 210
TCFDIFSHDPAVVVVDEVSIDSILYPTAWYNTLPLLSAVPFHSAWAKAMGVNLLAANTHNTSMHMTGSGI    211 - 280
YAPEAVKVYHYDMETESGQLLLSELKSRPRREPTYPAAVDWHAYASSVKPFSSEQSDFLGMIYFDEFTFT    281 - 350
KLKRNTGNYTACQKDLCCHLTYKMSEKRTDEIYALGAFDGLHTVEGQYYLQICALLKCQTTDLETCGEPV    351 - 420
GSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDP    421 - 490
PRLGQGSGKFQ                                                               491 - 501
//

Text Mined References (9)

PMID Year Title