Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.63
PubTator Score 0.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 8.300 0.000
cutaneous lupus erythematosus 2.000 0.017
osteosarcoma -3.220 0.000
lung cancer -2.400 0.000
cystic fibrosis 1.200 0.005
nasopharyngeal carcinoma -1.400 0.000
lung carcinoma -1.600 0.000
mucosa-associated lymphoid tissue lympho... 1.139 0.045

Gene RIF (1)

PMID Text
19322213 vanin-1 and vanin-3 are induced at the mRNA and protein level by psoriasis-associated proinflammatory cytokines (Th17/Th1) but not by Th2 cytokines.

AA Sequence

MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAK      1 - 70
QGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANI     71 - 140
GDKKPCNASDSQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIF    141 - 210
TCFDIFSHDPAVVVVDEVSIDSILYPTAWYNTLPLLSAVPFHSAWAKAMGVNLLAANTHNTSMHMTGSGI    211 - 280
YAPEAVKVYHYDMETESGQLLLSELKSRPRREPTYPAAVDWHAYASSVKPFSSEQSDFLGMIYFDEFTFT    281 - 350
KLKRNTGNYTACQKDLCCHLTYKMSEKRTDEIYALGAFDGLHTVEGQYYLQICALLKCQTTDLETCGEPV    351 - 420
GSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDP    421 - 490
PRLGQGSGKFQ                                                               491 - 501
//

Text Mined References (9)

PMID Year Title
19932582 2010 Pharmacologic concentrations of ascorbic acid cause diverse influence on differential expressions of angiogenic chemokine genes in different hepatocellular carcinoma cell lines.
19322213 2009 Expression of the vanin gene family in normal and inflamed human skin: induction by proinflammatory cytokines.
18805469 2008 Alternative spliced variants in the pantetheinase family of genes expressed in human neutrophils.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11491533 Vanin genes are clustered (human 6q22-24 and mouse 10A2B1) and encode isoforms of pantetheinase ectoenzymes.
10501839 1999 An ESTs description of the new Vanin gene family conserved from fly to human.