Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.95
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Pancreatic Neoplasm 79
Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.66844655257051E-11
glioblastoma 5572 3.13589214430651E-8
pediatric high grade glioma 2712 3.7341935705273E-7
pilocytic astrocytoma 3086 8.6779521239586E-6
atypical teratoid / rhabdoid tumor 4369 1.13908076907134E-5
primitive neuroectodermal tumor 3031 1.33976577420843E-5
sonic hedgehog group medulloblastoma 1482 1.95749198248193E-4
lung cancer 4473 0.00875221108290121
Disease Target Count Z-score Confidence
Endometriosis 535 0.0 2.0

Expression

Synonym

Accession Q9NY74 Q05BT7 Q53SC4
Symbols ETAA16

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
16003559 results suggest that ETAA16 may function as a tumour-specific cell surface antigen in Ewing's family of tumors

AA Sequence

MSRRRKHDDSPSPKKTPHKTVAAEECGSVVEPGRRRLRSARGSWPCGAREGPPGPVRQREQPPTAALCSK      1 - 70
SNPEERYETPKRALKMDSLSSSFSSPNDPDGQNDIFWDQNSPLTKQLGKGRKKQIYTTDSDEISHIVNRI     71 - 140
APQDEKPTTNSMLDMWIGETAIPCTPSVAKGKSRAKISCTKLKTQSQEEELMKLAKQFDKNMEELDVIQE    141 - 210
QNKRNYDFTQMISETEILSNYKDNIQMWSLHNIVPEIDNATKKPIKGNTKISVANNQNSSQKPFDQIAEA    211 - 280
AFNAIFDGSTQKCSGQLSQELPEAFWSTSNTTFVKTNALKEEKIITNETLVIEKLSNKTPRSLSSQVDTP    281 - 350
IMTKSCVTSCTKEPETSNKYIDAFTTSDFEDDWENLLGSEPFAMQNIDMPELFPSKTAHVTDQKEICTFN    351 - 420
SKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNKLSTGNKMKFENSSNKIVI    421 - 490
QDEIQNCIVTSNLTKIKEDILTNSTEASERKSALNTRYSNEQKNKCILNQSIKAPVNTDLFGSANLGSKT    491 - 560
SVSNPNQTSASKVGSFFDDWNDPSFANEIIKACHQLDNTWEADDVDDDLLYQACDDIERLTQQQDIRKDS    561 - 630
KTSESICEINNNSEHGAKLTQQQDIRKDSKTSESICEINNNSEHGAKNMFAISKQGSNLVQSKHLNPGSI    631 - 700
SVQTSLTNSSQIDKPMKMEKGEMYGNSPRFLGATNLTMYSKISNCQINNLHVSYTNTDVPIQVNSSKLVL    701 - 770
PGSSSLNVTSDHMNTEITTYKKKLSTNQPCHKTVTDEAQSNLNTTVGFSKFTFTRMKNSQILSQFNQNCI    771 - 840
TGSMSDTKITQGVEKKKGVNPLLEEAVGQQSLVKLSESLKQSSKEEEEKNRKCSPEEIQRKRQEALVRRM    841 - 910
AKARASSVNAAPTSFL                                                          911 - 926
//

Text Mined References (11)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16003559 2006 Structure and function of ETAA16: a novel cell surface antigen in Ewing's tumours.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...