Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.50
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Pancreatic Neoplasms 85 0.0 0.0
Disease Target Count
Pancreatic Neoplasm 85
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Endometriosis 540 0.0 2.7

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 4.4e-04
Astrocytoma, Pilocytic 1.100 7.9e-06
atypical teratoid / rhabdoid tumor 1.300 1.1e-05
ependymoma 1.300 1.8e-09
glioblastoma 1.300 3.1e-08
lung cancer 1.200 8.8e-03
medulloblastoma 1.100 3.9e-05
primitive neuroectodermal tumor 1.300 1.3e-05

 GO Component (1)

Gene RIF (5)

AA Sequence

MSRRRKHDDSPSPKKTPHKTVAAEECGSVVEPGRRRLRSARGSWPCGAREGPPGPVRQREQPPTAALCSK      1 - 70
SNPEERYETPKRALKMDSLSSSFSSPNDPDGQNDIFWDQNSPLTKQLGKGRKKQIYTTDSDEISHIVNRI     71 - 140
APQDEKPTTNSMLDMWIGETAIPCTPSVAKGKSRAKISCTKLKTQSQEEELMKLAKQFDKNMEELDVIQE    141 - 210
QNKRNYDFTQMISETEILSNYKDNIQMWSLHNIVPEIDNATKKPIKGNTKISVANNQNSSQKPFDQIAEA    211 - 280
AFNAIFDGSTQKCSGQLSQELPEAFWSTSNTTFVKTNALKEEKIITNETLVIEKLSNKTPRSLSSQVDTP    281 - 350
IMTKSCVTSCTKEPETSNKYIDAFTTSDFEDDWENLLGSEPFAMQNIDMPELFPSKTAHVTDQKEICTFN    351 - 420
SKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNKLSTGNKMKFENSSNKIVI    421 - 490
QDEIQNCIVTSNLTKIKEDILTNSTEASERKSALNTRYSNEQKNKCILNQSIKAPVNTDLFGSANLGSKT    491 - 560
SVSNPNQTSASKVGSFFDDWNDPSFANEIIKACHQLDNTWEADDVDDDLLYQACDDIERLTQQQDIRKDS    561 - 630
KTSESICEINNNSEHGAKLTQQQDIRKDSKTSESICEINNNSEHGAKNMFAISKQGSNLVQSKHLNPGSI    631 - 700
SVQTSLTNSSQIDKPMKMEKGEMYGNSPRFLGATNLTMYSKISNCQINNLHVSYTNTDVPIQVNSSKLVL    701 - 770
PGSSSLNVTSDHMNTEITTYKKKLSTNQPCHKTVTDEAQSNLNTTVGFSKFTFTRMKNSQILSQFNQNCI    771 - 840
TGSMSDTKITQGVEKKKGVNPLLEEAVGQQSLVKLSESLKQSSKEEEEKNRKCSPEEIQRKRQEALVRRM    841 - 910
AKARASSVNAAPTSFL                                                          911 - 926
//

Text Mined References (17)

PMID Year Title