Property Summary

NCBI Gene PubMed Count 35
Grant Count 1
Funding $41,805.56
PubMed Score 9.44
PubTator Score 7.02

Knowledge Summary

Patent (692)

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -3.300 0.004
psoriasis -1.600 0.003
glioblastoma -3.800 0.000
oligodendroglioma -2.200 0.000
osteosarcoma 1.467 0.004
posterior fossa group A ependymoma -5.000 0.000
sonic hedgehog group medulloblastoma -3.100 0.002
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -3.100 0.004
lung cancer 1.600 0.003
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -4.500 0.000
lung carcinoma 2.000 0.000
Pick disease -2.300 0.006
ovarian cancer -1.200 0.000
pituitary cancer 1.400 0.001

Synonym

Accession Q9NY72 A5H1I5 Q17RL3 Q9ULR2
Symbols SCNB3
ATFB16
BRGDA7
HSA243396

Gene

 Grant Application (1)

PDB

4L1D  

Gene RIF (18)

PMID Text
26179811 Contribution of Cardiac Sodium Channel beta-Subunit Variants to Brugada Syndrome.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
25443231 SCN1-3B the gene that encode respectively a- and b-subunits of the cardiac fast voltage-gated sodium channel, have been linked to atrial fibrillation.
23257389 The Val110Ile mutation of SCN3B is a relatively common cause of SCN5A-negative BrS in Japan, which has a reduced sodium current because of the loss of cell surface expression of Nav1.5.
23118027 the beta3 subunit can mediate trans homophilic-binding via its Ig domain and the beta3-Ig domain can associate heterophilically with the beta1 subunit
21051419 three mutations in SCN3B were investigated electrophysiologically and all led to loss of function in the sodium current, supporting the hypothesis that decreased sodium current enhances atrial fibrillation susceptibility
21051419 Observational study of gene-disease association. (HuGE Navigator)
20675377 The sodium channel {beta}3-subunit induces multiphasic gating in NaV1.3 and affects fast inactivation via distinct intracellular regions.
20558140 This study identifies the first atrial fibrillation(AF) -associated mutation in SCN3B, and suggests that mutations in SCN3B may be a new pathogenic cause of AF.
20558140 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGK      1 - 70
DFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRL     71 - 140
IPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSA    141 - 210
VPVEE                                                                     211 - 215
//

Text Mined References (35)

PMID Year Title
26179811 2015 Contribution of Cardiac Sodium Channel ?-Subunit Variants to Brugada Syndrome.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
25443231 2014 Risk factors and genetics of atrial fibrillation.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23257389 2013 Novel SCN3B mutation associated with brugada syndrome affects intracellular trafficking and function of Nav1.5.
23118027 2013 The immunoglobulin domain of the sodium channel ?3 subunit contains a surface-localized disulfide bond that is required for homophilic binding.
21895525 2011 Multiple arrhythmic syndromes in a newborn, owing to a novel mutation in SCN5A.
21051419 2011 Mutations in sodium channel ?-subunit SCN3B are associated with early-onset lone atrial fibrillation.
20675377 2010 The sodium channel {beta}3-subunit induces multiphasic gating in NaV1.3 and affects fast inactivation via distinct intracellular regions.
More...