Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 4
Funding $215,884.22
PubMed Score 34.76
PubTator Score 13.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Placental insufficiency 13 3.0 1.5

Expression

Gene RIF (7)

PMID Text
24519932 GLUT8 is thus essential for hepatocyte fructose transport and fructose-induced macrosteatosis.
23234877 SLC2A8 is upregulated in fast progressing Alzheimer's disease patients, compared to slow progressors.
22452979 Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
20965718 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of GLUT8 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
16723738 The recruitment of GLUT8 to the endocytic machinery occurs via direct interaction of the dileucine motif with beta2-adaptin, and that endocytosis might be the main site at which GLUT8 is likely to be regulated.
11845330 This carrier protein is expressed in human tissues of the testis in a gonadotropin-dependent manner.

AA Sequence

MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAAS      1 - 70
WFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLV     71 - 140
APVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLL    141 - 210
TQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAE    211 - 280
TIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNS    281 - 350
SHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM    351 - 420
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR                 421 - 477
//

Text Mined References (18)

PMID Year Title
24519932 2014 Glucose transporter 8 (GLUT8) mediates fructose-induced de novo lipogenesis and macrosteatosis.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23234877 2013 Gene expression profiling of peripheral blood leukocytes shows consistent longitudinal downregulation of TOMM40 and upregulation of KIR2DL5A, PLOD1, and SLC2A8 among fast progressors in early Alzheimer's disease.
22452979 2012 Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
21269460 2011 Initial characterization of the human central proteome.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19176349 2009 GLUT8, the enigmatic intracellular hexose transporter.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
More...