Property Summary

NCBI Gene PubMed Count 47
Grant Count 37
R01 Count 31
Funding $4,073,929.4
PubMed Score 147.23
PubTator Score 53.13

Knowledge Summary

Patent

No data available

Gene RIF (23)

PMID Text
27012205 loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53
26822515 It was concluded that PARP-1 was involved in the DNA damage repair induced by HQ via increasing the accumulation of apoptosis antagonizing transcription factor through PARylation.
25996291 These results confirm Che-1 as an important regulator of p53 activity and suggest Che-1 to be a promising yet attractive drug target for cancer therapy.
25976474 In the face of high glucose threat, mitochondrial UCP2 gene expression is regulated by miR-2909 and AATF.
25770584 Che-1 expression correlates with the progression of multiple myeloma and is required for cell growth and survival.Che-1 controls mTOR through the induction of Redd1 and Deptor, two important repressors of mTOR.
25231211 This mutant AATF along with its interactome consisting of SP1, DNMT3B and Par-4 ensures cancer cell DNA methylation required for down-regulation of tumor suppressor genes.
25210797 HIPK2 depletion strongly decreases Che-1 ubiquitylation and degradation.
23801113 Cell proliferation decreased by 41% which was accompanied by apoptosis induction in 30% MCF-7 cells after AATF gene knockdown.
23798705 Che-1 depletion abolishes the ability of Chk1 to bind pericentrin and to localize at centrosomes, which, in its turn, deregulates the activation of centrosomal cyclin B-Cdk1 and advances entry into mitosis.
22933572 These results identify AATF as a nucleolar-confined c-Jun cofactor whose expression levels and spatial distribution determine the stress-induced activity of c-Jun and the levels of c-Jun-mediated apoptosis.
More...

AA Sequence

MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKR      1 - 70
YCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSR     71 - 140
SHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVM    141 - 210
TFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHK    211 - 280
ALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPS    281 - 350
FMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVL    351 - 420
GKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQ    421 - 490
WLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD    491 - 560
//

Text Mined References (54)

PMID Year Title
27012205 2016 Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression.
26822515 2016 Poly(ADP-ribosyl)ation of Apoptosis Antagonizing Transcription Factor Involved in Hydroquinone-Induced DNA Damage Response.
25996291 2015 Che-1 modulates the decision between cell cycle arrest and apoptosis by its binding to p53.
25976474 2015 Mitochondrial uncoupling protein (UCP2) gene expression is regulated by miR-2909.
25770584 2015 Che-1-induced inhibition of mTOR pathway enables stress-induced autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25231211 2015 Oncogenic nature of a novel mutant AATF and its interactome existing within human cancer cells.
25210797 2014 HIPK2 sustains apoptotic response by phosphorylating Che-1/AATF and promoting its degradation.
23801113 2013 Apoptosis-antagonizing transcription factor (AATF) gene silencing: role in induction of apoptosis and down-regulation of estrogen receptor in breast cancer cells.
23798705 2013 Centrosomal Che-1 protein is involved in the regulation of mitosis and DNA damage response by mediating pericentrin (PCNT)-dependent Chk1 protein localization.
More...