Property Summary

NCBI Gene PubMed Count 47
PubMed Score 147.23
PubTator Score 53.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00368640265497741

Synonym

Accession Q9NY61 A6NCJ6 B3KQ26 Q9P0A4 Q9UNX5
Symbols DED
BFR2
CHE1
CHE-1

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GWAS Trait (1)

Gene RIF (23)

PMID Text
27012205 loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53
26822515 It was concluded that PARP-1 was involved in the DNA damage repair induced by HQ via increasing the accumulation of apoptosis antagonizing transcription factor through PARylation.
25996291 These results confirm Che-1 as an important regulator of p53 activity and suggest Che-1 to be a promising yet attractive drug target for cancer therapy.
25976474 In the face of high glucose threat, mitochondrial UCP2 gene expression is regulated by miR-2909 and AATF.
25770584 Che-1 expression correlates with the progression of multiple myeloma and is required for cell growth and survival.Che-1 controls mTOR through the induction of Redd1 and Deptor, two important repressors of mTOR.
25231211 This mutant AATF along with its interactome consisting of SP1, DNMT3B and Par-4 ensures cancer cell DNA methylation required for down-regulation of tumor suppressor genes.
25210797 HIPK2 depletion strongly decreases Che-1 ubiquitylation and degradation.
23801113 Cell proliferation decreased by 41% which was accompanied by apoptosis induction in 30% MCF-7 cells after AATF gene knockdown.
23798705 Che-1 depletion abolishes the ability of Chk1 to bind pericentrin and to localize at centrosomes, which, in its turn, deregulates the activation of centrosomal cyclin B-Cdk1 and advances entry into mitosis.
22933572 These results identify AATF as a nucleolar-confined c-Jun cofactor whose expression levels and spatial distribution determine the stress-induced activity of c-Jun and the levels of c-Jun-mediated apoptosis.
More...

AA Sequence

MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKR      1 - 70
YCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSR     71 - 140
SHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVM    141 - 210
TFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHK    211 - 280
ALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPS    281 - 350
FMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVL    351 - 420
GKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQ    421 - 490
WLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD    491 - 560
//

Text Mined References (54)

PMID Year Title
27012205 2016 Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression.
26822515 2016 Poly(ADP-ribosyl)ation of Apoptosis Antagonizing Transcription Factor Involved in Hydroquinone-Induced DNA Damage Response.
25996291 2015 Che-1 modulates the decision between cell cycle arrest and apoptosis by its binding to p53.
25976474 2015 Mitochondrial uncoupling protein (UCP2) gene expression is regulated by miR-2909.
25770584 2015 Che-1-induced inhibition of mTOR pathway enables stress-induced autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25231211 2015 Oncogenic nature of a novel mutant AATF and its interactome existing within human cancer cells.
25210797 2014 HIPK2 sustains apoptotic response by phosphorylating Che-1/AATF and promoting its degradation.
23801113 2013 Apoptosis-antagonizing transcription factor (AATF) gene silencing: role in induction of apoptosis and down-regulation of estrogen receptor in breast cancer cells.
23798705 2013 Centrosomal Che-1 protein is involved in the regulation of mitosis and DNA damage response by mediating pericentrin (PCNT)-dependent Chk1 protein localization.
More...