Property Summary

NCBI Gene PubMed Count 35
PubMed Score 78.53
PubTator Score 48.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-03
Astrocytoma, Pilocytic -1.500 2.7e-09
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
colon cancer -1.100 1.0e-02
ependymoma -2.100 3.6e-20
glioblastoma -1.400 7.0e-07
intraductal papillary-mucinous adenoma (... 1.100 1.6e-03
lung carcinoma 3.300 6.3e-31
osteosarcoma 2.037 1.0e-02
ovarian cancer -3.400 9.9e-27
psoriasis 1.600 2.9e-08

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (31)

AA Sequence

MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLAL      1 - 70
LVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLAR     71 - 140
VNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASV    141 - 210
EYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTP    211 - 280
NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVS    281 - 350
AFFPANLDFLCLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY    351 - 420
HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQDWLADFRKST    421 - 490
SSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTNGLYDE    491 - 560
DVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFI    561 - 630
TQLSGLTDHLPVAMRLMVSSGEEEA                                                 631 - 655
//

Text Mined References (37)

PMID Year Title