Property Summary

NCBI Gene PubMed Count 30
PubMed Score 71.16
PubTator Score 48.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Leukemia 88
MYELODYSPLASTIC SYNDROME 39
Disease Target Count P-value
lung carcinoma 2844 6.27593590593763E-31
ovarian cancer 8492 9.87048780103689E-27
ependymoma 2514 3.56109421065612E-20
pilocytic astrocytoma 3086 1.24673615788507E-9
psoriasis 6685 2.86100395182019E-8
pediatric high grade glioma 2712 5.76736196397497E-7
glioblastoma 5572 2.02035756076734E-5
atypical teratoid / rhabdoid tumor 4369 1.16928819948668E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00158015038333855
colon cancer 1475 0.0100347798463077
osteosarcoma 7933 0.0103226790711531
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 4.371 2.2
Dentinogenesis imperfecta 24 3.256 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 2.037 0.010
ependymoma -2.100 0.000
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.002
colon cancer -1.100 0.010
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.500 0.000
lung carcinoma 3.300 0.000
ovarian cancer -3.400 0.000

Synonym

Accession Q9NY59 B7ZL82 Q2M1S8
Symbols NSMASE2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (27)

PMID Text
26512957 nSMase2 is a novel p53 target gene, regulated by the DNA damage pathway to induce cell growth arrest.
25465297 nSMase2 involvement in cellular processes including inflammatory signaling, exosome generation, cell growth, and apoptosis, which in turn play important roles in pathologies such as cancer metastasis, Alzheimer's disease
25394686 SMPD3 plays an important role in the release of microRNAs into extracellular spaces.
25180167 The data shows that nSMase3 acts as a signaling nSMase in skeletal muscle that is essential for TNF-stimulated oxidant activity.
25047167 These results suggest that OTC is a potent stimulant of nSMase-2 expression and that there may be unanticipated complications of OTC supplementation.
24960545 We found upregulation of specific sphingolipid enzymes, namely sphingomyelin synthase 1 (SMS1), sphingomyelinase 3 (SMPD3), and glucosylceramide synthase (GCS) in the endometrium of endometriotic women.
24694597 This is the first report on the critical role of ceramide generated by nSMase2 in stem cell ciliogenesis and differentiation.
23651497 The H2O2-induced src/PDGFRbeta/SK1 signaling cascade was impaired in nSMase2-deficient fro/fro cells and was rescued by exogenous C2Cer that activated src/PDGFRbeta/SK1.
23439645 a requirement for nSMase2-mediated cancer cell exosomal miRNAs in the regulation of metastasis through the induction of angiogenesis in inoculated tumors.
22721673 HIV-1 Nef inhibits sphingomyelinase activity in human podocyte
More...

AA Sequence

MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLAL      1 - 70
LVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLAR     71 - 140
VNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASV    141 - 210
EYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTP    211 - 280
NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVS    281 - 350
AFFPANLDFLCLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY    351 - 420
HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQDWLADFRKST    421 - 490
SSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTNGLYDE    491 - 560
DVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFI    561 - 630
TQLSGLTDHLPVAMRLMVSSGEEEA                                                 631 - 655
//

Text Mined References (32)

PMID Year Title
26512957 2015 P53-dependent upregulation of neutral sphingomyelinase-2: role in doxorubicin-induced growth arrest.
25465297 2015 Roles and regulation of neutral sphingomyelinase-2 in cellular and pathological processes.
25394686 2015 Secretion of small/microRNAs including miR-638 into extracellular spaces by sphingomyelin phosphodiesterase 3.
25180167 2014 Neutral sphingomyelinase-3 mediates TNF-stimulated oxidant activity in skeletal muscle.
25047167 2014 Effect of procysteine on aging-associated changes in hepatic GSH and SMase: evidence for transcriptional regulation of smpd3.
24960545 2014 Dysregulated sphingolipid metabolism in endometriosis.
24694597 2014 Primary cilia in stem cells and neural progenitors are regulated by neutral sphingomyelinase 2 and ceramide.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23651497 2013 A signaling cascade mediated by ceramide, src and PDGFR? coordinates the activation of the redox-sensitive neutral sphingomyelinase-2 and sphingosine kinase-1.
23439645 2013 Neutral sphingomyelinase 2 (nSMase2)-dependent exosomal transfer of angiogenic microRNAs regulate cancer cell metastasis.
More...