Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.24
PubTator Score 1.75

Knowledge Summary

Patent (1,760)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
pilocytic astrocytoma 3086 3.71108955861877E-11
ovarian cancer 8492 2.00127325565E-7
cystic fibrosis 1670 3.11614554221803E-7
glioblastoma 5572 1.40646887883839E-5
adult high grade glioma 2148 4.0202332079192E-4
psoriasis 6685 0.0012370129586814
nephrosclerosis 329 0.00700545124311104
colon cancer 1475 0.0224700353160371
primitive neuroectodermal tumor 3031 0.0370300599036951
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0
Disease Target Count Z-score Confidence
Ellis-Van Creveld syndrome 19 4.088 2.0
Essential tremor 30 3.218 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.117 0.007
psoriasis -1.900 0.001
glioblastoma 1.900 0.000
cystic fibrosis -2.580 0.000
primitive neuroectodermal tumor 1.600 0.037
colon cancer -1.300 0.022
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 3.300 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9NY57 Q6UXH3 Q8IY14
Symbols STK32
STKG6
YANK2
HSA250839

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20087401 STK32B and EVC yielded consistent evidence from cleft lip, with or without cleft palate, trios in all four populations.
20087401 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18454448 In a consanguineous pedigree diagnosed with EvC and borderline intelligence, a 520-kb homozygous deletion comprising EVC, EVC2, C4orf6, and STK32B, caused by recombination between LINE-1 elements, was detected

AA Sequence

MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCIERDEVRNVFR      1 - 70
ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRY     71 - 140
HIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSMAGTKPYMAPEVFQVYMDRGPGYSYPVDWWS    141 - 210
LGITAYELLRGWRPYEIHSVTPIDEILNMFKVERVHYSSTWCKGMVALLRKLLTKDPESRVSSLHDIQSV    211 - 280
PYLADMNWDAVFKKALMPGFVPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGH    281 - 350
LQHCLETVREEFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS          351 - 414
//

Text Mined References (17)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23834954 2013 Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20087401 2010 Association between genes on chromosome 4p16 and non-syndromic oral clefts in four populations.
19389651 2009 Genome-wide association study of electrocardiographic conduction measures in an isolated founder population: Kosrae.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18454448 2008 Long interspersed nuclear element-1 (LINE1)-mediated deletion of EVC, EVC2, C4orf6, and STK32B in Ellis-van Creveld syndrome with borderline intelligence.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...