Property Summary

Ligand Count 1
NCBI Gene PubMed Count 17
PubMed Score 2.56
PubTator Score 1.75

Knowledge Summary

Patent (1,760)

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.700 4.0e-04
Astrocytoma, Pilocytic 3.400 1.8e-11
colon cancer -1.300 2.2e-02
cystic fibrosis -2.580 3.1e-07
glioblastoma 1.900 1.4e-05
nephrosclerosis -1.117 7.0e-03
ovarian cancer -1.300 2.0e-07
primitive neuroectodermal tumor 1.600 3.7e-02
psoriasis -1.900 1.2e-03

Gene RIF (6)

AA Sequence

MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCIERDEVRNVFR      1 - 70
ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRY     71 - 140
HIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSMAGTKPYMAPEVFQVYMDRGPGYSYPVDWWS    141 - 210
LGITAYELLRGWRPYEIHSVTPIDEILNMFKVERVHYSSTWCKGMVALLRKLLTKDPESRVSSLHDIQSV    211 - 280
PYLADMNWDAVFKKALMPGFVPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGH    281 - 350
LQHCLETVREEFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS          351 - 414
//

Text Mined References (18)

PMID Year Title