Property Summary

NCBI Gene PubMed Count 10
Grant Count 44
R01 Count 36
Funding $10,211,546.44
PubMed Score 10.03
PubTator Score 88.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (3)

PMID Text
25810031 Studied the crystallographic structure of human odorant-binding protein, OBPIIa at 2.6 A resolution.
16546182 Lys112 is the major determinant for governing hOBP-2A specificity towards aldehydes and small carboxylic acids.
12044155 hOBPIIa(alpha) is expressed in the nasal mucus covering the olfactory cleft and is able to bind numerous odorants of diverse chemical structures, with a higher affinity for aldehydes and large fatty acids.

AA Sequence

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR      1 - 70
EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL     71 - 140
EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH                                            141 - 170
//

Text Mined References (11)

PMID Year Title
25810031 2015 Crystal structure of the human odorant binding protein, OBPIIa.
23267103 2013 Linkage analysis identifies a locus for plasma von Willebrand factor undetected by genome-wide association.
16546182 2006 A single lysyl residue defines the binding specificity of a human odorant-binding protein for aldehydes.
16461020 2006 Comparative ligand-binding analysis of ten human lipocalins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379593 2002 Porcine odorant-binding protein selectively binds to a human olfactory receptor.
12044155 2002 Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties.
11058764 2000 Mammalian odorant binding proteins.
More...