Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.28
PubTator Score 88.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.5e-16
osteosarcoma 7950 2.4e-03
Disease Target Count Z-score Confidence
Syringomyelia 15 4.765 2.4
Radiculopathy 14 3.244 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.065 2.4e-03
psoriasis -1.600 2.5e-16

Gene RIF (3)

AA Sequence

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR      1 - 70
EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL     71 - 140
EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH                                            141 - 170
//

Text Mined References (11)

PMID Year Title