Property Summary

Ligand Count 36
NCBI Gene PubMed Count 27
PubMed Score 87.02
PubTator Score 50.71

Knowledge Summary

Patent (10,209)


  Disease (5)

Disease Target Count Z-score Confidence
Epilepsy, Complex Partial 1 0.0 0.0
Disease Target Count
Epilepsy 792
Administration of Corneal Anesthesia 6
Administration of Local Anesthetic Nerve Block 14
Administration of Regional Anesthesia 7
Anesthesia for cesarean section 8
Atrial Fibrillation 124
Bipolar disorder in remission 19
Cardioversion of Atrial Fibrillation 9
Cough 23
Dysuria 26
Epilepsy characterized by intractable complex partial seizures 28
Hemorrhoids 13
Infestation by Phthirus pubis 7
Infestation by Sarcoptes scabiei var hominis 7
Itching of skin 18
Lennox-Gastaut syndrome 34
Life-Threatening Ventricular Tachycardia 15
Local Anesthesia for Endotracheal Intubation 6
Local Anesthesia for Ophthalmologic Procedure 7
Local Anesthesia for Urethral Pain 6
Local anesthesia 40
Local anesthesia, by infiltration 14
Local anesthetic intrathecal block 7
Localization-related epilepsy 13
Major Nerve Block for Surgery 8
Malaria 160
Minor Skin Wound Pain 12
Motor cortex epilepsy 10
Mouth Irritation 12
Neuralgia 20
Partial seizure 15
Pediculosis capitis 7
Postherpetic neuralgia 11
Premature ejaculation 16
Prevent Minor Bacterial Skin Infection 10
Prevention of Seizures following Cranial Trauma or Surgery 7
Pruritus ani 14
Pseudobulbar affect 5
Regional Anesthesia for Labor Pain 9
Regional Anesthesia for Ophthalmologic Surgery 6
Regional Anesthesia for Postoperative Pain 9
Regional Anesthesia for Surgery 9
Seizures in Neurosurgery 7
Simple partial seizure 26
Skin irritation 12
Sore throat symptom 12
Status Epilepticus 98
Suppression of the Gag Reflex 12
Tinea Infections 10
Tinea corporis 25
Tinea pedis 29
Tonic-clonic epilepsy 47
Tonic-clonic seizure 11
Urethritis 10
Urinary Tract Irritation 24
Ventricular arrhythmia 27
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.9
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.6


  Differential Expression (20)

Disease log2 FC p
Breast cancer -2.400 1.6e-67
breast carcinoma -1.300 1.0e-22
Chronic Lymphocytic Leukemia -3.502 1.4e-07
colon cancer -2.200 2.3e-06
ependymoma -2.600 1.8e-06
glioblastoma -2.300 3.1e-02
interstitial cystitis 1.500 4.2e-03
invasive ductal carcinoma -1.500 7.6e-03
lung adenocarcinoma 1.500 2.7e-07
lung cancer 1.400 1.1e-02
lung carcinoma 4.500 1.4e-40
malignant mesothelioma 2.100 8.0e-06
medulloblastoma -1.300 4.1e-02
medulloblastoma, large-cell -2.600 1.4e-03
osteosarcoma -3.138 1.4e-03
primary Sjogren syndrome 1.100 2.9e-03
psoriasis -1.600 6.8e-03
severe Alzheimer's disease -1.112 3.9e-02
tuberculosis 1.400 7.2e-03
Waldenstrons macroglobulinemia -3.478 2.2e-06

Gene RIF (16)

AA Sequence

SSSTTSPPSYDSVTKPDKEKFEKDKPEKESKGKEVRENQK                                 1961 - 2000

Text Mined References (31)

PMID Year Title