Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.51
PubTator Score 3.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 1.7
Mental Depression 333 0.0 2.1

Expression

AA Sequence

MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTM      1 - 70
EPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTS     71 - 140
SFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGT    141 - 210
KEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY    211 - 280
QNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHP    281 - 350
QLQRPLVPRVLIHGLGPGGQPALNPLSSPIPGTPHPR                                     351 - 387
//

Text Mined References (5)

PMID Year Title