Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.75
PubTator Score 6.33

Knowledge Summary

Patent (577)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Alcohol dependence 107 3.554 1.8

Synonym

Accession Q9NY37 ASIC5
Symbols INAC
ACCN5
HINAC

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
23842738 hBASIC shares further key features with its rat ortholog: it is blocked by extracellular divalent cations, is inhibited by micromolar concentrations of the diarylamidine diminazene, and activated by millimolar concentrations of flufenamic acid.

AA Sequence

MEQTEKSKVYAENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKIRRVLWLVVVL      1 - 70
GSVSLVTWQIYIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLH     71 - 140
LQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTF    141 - 210
NHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHAR    211 - 280
VTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSC    281 - 350
VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI    351 - 420
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQWTP    421 - 490
PPQNHLGNKNRIEEC                                                           491 - 505
//

Text Mined References (2)

PMID Year Title
23842738 2014 Pharmacological and electrophysiological characterization of the human bile acid-sensitive ion channel (hBASIC).
10767424 2000 Molecular cloning, functional expression and chromosomal localization of an amiloride-sensitive Na(+) channel from human small intestine.