Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.75
PubTator Score 6.33

Knowledge Summary

Patent (577)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Alcohol dependence 107 3.554 1.8

Gene RIF (1)

PMID Text
23842738 hBASIC shares further key features with its rat ortholog: it is blocked by extracellular divalent cations, is inhibited by micromolar concentrations of the diarylamidine diminazene, and activated by millimolar concentrations of flufenamic acid.

AA Sequence

MEQTEKSKVYAENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKIRRVLWLVVVL      1 - 70
GSVSLVTWQIYIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLH     71 - 140
LQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTF    141 - 210
NHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHAR    211 - 280
VTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSC    281 - 350
VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI    351 - 420
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQWTP    421 - 490
PPQNHLGNKNRIEEC                                                           491 - 505
//

Publication (2)

PMID Year Title
23842738 2014 Pharmacological and electrophysiological characterization of the human bile acid-sensitive ion channel (hBASIC).
10767424 2000 Molecular cloning, functional expression and chromosomal localization of an amiloride-sensitive Na(+) channel from human small intestine.