Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.86
PubTator Score 3.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.09297584015573E-19
osteosarcoma 7933 1.71425684315023E-8
tuberculosis 1563 1.63348404469334E-6
malignant mesothelioma 3163 3.91834501972164E-6
ovarian cancer 8492 6.52446009918779E-6
atypical teratoid/rhabdoid tumor 1095 1.00558728912801E-5
ependymoma 2514 2.55387358795795E-5
Down syndrome 548 2.72474221581839E-4
lung adenocarcinoma 2714 2.78092282484435E-4
medulloblastoma, large-cell 6234 0.00126692644802257
group 4 medulloblastoma 1875 0.00600193631870184
primary Sjogren syndrome 789 0.00774800877727271
subependymal giant cell astrocytoma 2287 0.0136983066847215
spina bifida 1064 0.0465322755972957

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -3.264 0.000
ependymoma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.600 0.001
tuberculosis -1.900 0.000
non-small cell lung cancer -1.038 0.000
group 4 medulloblastoma -1.300 0.006
primary Sjogren syndrome 1.100 0.008
subependymal giant cell astrocytoma -3.676 0.014
lung adenocarcinoma 1.222 0.000
spina bifida -1.083 0.047
ovarian cancer -1.900 0.000
Down syndrome 1.800 0.000

Synonym

Accession Q9NY35 B3KQR1 D3DN36 F2Z2D9 Q502Y8 Q6UVX2 Q9BUZ9 Q9NZZ5 Q9Y4S9
Symbols C3orf4
GENX-3745

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
26083392 CLDND1 as a novel survival factor in basal-like breast cancer cell lines
18187620 Knockdown of claudin domain containing 1 (CLDND1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17316888 A cDNA library consisting of 220 upregulated genes in tumour tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1.

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR      1 - 70
YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ     71 - 140
FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG    141 - 210
EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA                               211 - 253
//

Text Mined References (15)

PMID Year Title
26083392 2015 Down Regulation of CLDND1 Induces Apoptosis in Breast Cancer Cells.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17316888 2007 Identification of genes differentially expressed in human primary lung squamous cell carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...