Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.02
PubTator Score 3.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 9.3e-05
Down syndrome 1.800 2.7e-04
ependymoma -1.100 2.6e-05
group 4 medulloblastoma -1.300 6.0e-03
lung adenocarcinoma 1.222 2.8e-04
malignant mesothelioma 1.400 3.9e-06
medulloblastoma, large-cell -1.600 1.3e-03
non-small cell lung cancer -1.038 2.1e-19
osteosarcoma -1.274 6.3e-05
ovarian cancer -1.900 6.5e-06
primary Sjogren syndrome 1.100 7.7e-03
spina bifida -1.083 4.7e-02
subependymal giant cell astrocytoma -2.566 2.5e-03
tuberculosis -1.100 2.1e-06

Gene RIF (4)

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR      1 - 70
YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ     71 - 140
FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG    141 - 210
EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA                               211 - 253
//

Text Mined References (17)

PMID Year Title