Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.61
PubTator Score 7.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
malignant mesothelioma 3,162

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000

Gene RIF (4)

PMID Text
20309940 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19576178 these data support BTG4 as a candidate tumor suppressor gene that is epigenetically silenced in the majority of gastric cancers.
18519671 miR-34b/c and BTG4 are novel tumor suppressors in colorectal cancer (CRC) and that the miR-34b/c CpG island, which bidirectionally regulates miR-34b/c and BTG4, is a frequent target of epigenetic silencing in CRC
15672409 BTG4 could contribute to chronic lymphocytic leykemia pathogenesis following inactivation by haploinsufficiency.

AA Sequence

MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDP      1 - 70
ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSD     71 - 140
VSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPK    141 - 210
CYRPAMHRLDRIL                                                             211 - 223
//

Publication (10)

PMID Year Title
20309940 2011 A potentially functional polymorphism in the promoter region of miR-34b/c is associated with an increased risk for primary hepatocellular carcinoma.
19576178 2009 Frequent promoter hypermethylation and transcriptional downregulation of BTG4 gene in gastric cancer.
18519671 2008 Epigenetic silencing of microRNA-34b/c and B-cell translocation gene 4 is associated with CpG island methylation in colorectal cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15672409 2005 Identification of a potential role for POU2AF1 and BTG4 in the deletion of 11q23 in chronic lymphocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11429045 2001 Association of ANA, a member of the antiproliferative Tob family proteins, with a Caf1 component of the CCR4 transcriptional regulatory complex.
11267995 2001 The gene PC3(TIS21/BTG2), prototype member of the PC3/BTG/TOB family: regulator in control of cell growth, differentiation, and DNA repair?
10995567 2000 Cloning of PC3B, a novel member of the PC3/BTG/TOB family of growth inhibitory genes, highly expressed in the olfactory epithelium.