Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.61
PubTator Score 7.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 4.057885697269E-6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000

Synonym

Accession Q9NY30 Q8NEH7
Symbols PC3B
APRO3

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
20309940 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19576178 these data support BTG4 as a candidate tumor suppressor gene that is epigenetically silenced in the majority of gastric cancers.
18519671 miR-34b/c and BTG4 are novel tumor suppressors in colorectal cancer (CRC) and that the miR-34b/c CpG island, which bidirectionally regulates miR-34b/c and BTG4, is a frequent target of epigenetic silencing in CRC
15672409 BTG4 could contribute to chronic lymphocytic leykemia pathogenesis following inactivation by haploinsufficiency.

AA Sequence

MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDP      1 - 70
ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSD     71 - 140
VSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPK    141 - 210
CYRPAMHRLDRIL                                                             211 - 223
//

Text Mined References (10)

PMID Year Title
20309940 2011 A potentially functional polymorphism in the promoter region of miR-34b/c is associated with an increased risk for primary hepatocellular carcinoma.
19576178 2009 Frequent promoter hypermethylation and transcriptional downregulation of BTG4 gene in gastric cancer.
18519671 2008 Epigenetic silencing of microRNA-34b/c and B-cell translocation gene 4 is associated with CpG island methylation in colorectal cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15672409 2005 Identification of a potential role for POU2AF1 and BTG4 in the deletion of 11q23 in chronic lymphocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11429045 2001 Association of ANA, a member of the antiproliferative Tob family proteins, with a Caf1 component of the CCR4 transcriptional regulatory complex.
11267995 2001 The gene PC3(TIS21/BTG2), prototype member of the PC3/BTG/TOB family: regulator in control of cell growth, differentiation, and DNA repair?
10995567 2000 Cloning of PC3B, a novel member of the PC3/BTG/TOB family of growth inhibitory genes, highly expressed in the olfactory epithelium.