Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.02
PubTator Score 7.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 4.1e-06
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 4.044 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 4.1e-06

Synonym

Accession Q9NY30 Q8NEH7
Symbols PC3B
APRO3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDP      1 - 70
ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSD     71 - 140
VSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPK    141 - 210
CYRPAMHRLDRIL                                                             211 - 223
//

Text Mined References (10)

PMID Year Title