Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.62
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 4.9e-03
atypical teratoid / rhabdoid tumor -2.400 1.9e-07
cutaneous lupus erythematosus -1.200 3.5e-03
glioblastoma -1.100 1.3e-02
medulloblastoma -1.100 4.2e-03
medulloblastoma, large-cell -2.000 3.0e-03
primitive neuroectodermal tumor -1.300 1.2e-02
psoriasis -1.100 1.7e-03

Gene RIF (4)

AA Sequence

MMFWRKLPKALFIGLTLAIAVNLLLVFSSKGTLQNLFTGGLHRELPLHLNKRYGAVIKRLSHLEVELQDL      1 - 70
KESMKLALRQQENVNSTLKRAKDEVRPLLKAMETKVNETKKHKTQMKLFPHSQLFRQWGEDLSEAQQKAA     71 - 140
QDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVILIFVNEALSIIQRAITSIINRTPS    141 - 210
RLLKEIILVDDFSSNGELKVHLDEKIKLYNQKYPGLLKIIRHPERKGLAQARNTGWEAATADVVAILDAH    211 - 280
IEVNVGWAEPILARIQEDRTVIVSPVFDNIRFDTFKLDKYELAVDGFNWELWCRYDALPQAWIDLHDVTA    281 - 350
PVKSPSIMGILAANRHFLGEIGSLDGGMLIYGGENVELSLRVWQCGGKVEILPCSRIAHLERHHKPYALD    351 - 420
LTAALKRNALRVAEIWMDEHKHMVYLAWNIPLQNSGIDFGDVSSRMALREKLKCKTFDWYLKNVYPLLKP    421 - 490
LHTIVGYGRMKNLLDENVCLDQGPVPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDP    491 - 560
GKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVRD    561 - 630
WGQTNSQ                                                                   631 - 637
//

Text Mined References (7)

PMID Year Title