Property Summary

NCBI Gene PubMed Count 32
PubMed Score 75.93
PubTator Score 51.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 4.7e-05
Astrocytoma, Pilocytic 1.300 8.3e-09
atypical teratoid / rhabdoid tumor 1.400 1.0e-06
ependymoma 1.100 8.5e-09
glioblastoma 1.300 2.4e-10
ovarian cancer 1.400 3.3e-07

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (22)

AA Sequence

MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALS      1 - 70
LVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPS     71 - 140
PLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMEL    141 - 210
CLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAA    211 - 280
GTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI                              281 - 324
//

Text Mined References (34)

PMID Year Title