Property Summary

NCBI Gene PubMed Count 32
Grant Count 52
R01 Count 39
Funding $6,674,606.94
PubMed Score 71.93
PubTator Score 51.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.100 0.000
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.300 0.000
ovarian cancer 1.400 0.000

Gene RIF (22)

PMID Text
26081940 Despite the fact that these preliminary findings are unlikely to be of much diagnostic significance, these findings suggest that hZip1 plays a fundamental role in the carcinogenesis of mucinous tumors.
24922175 The effect of zinc administered for 27 days on the expression of ZIP1 in peripheral white blood cells is reported.
24878177 Data suggest that high zrt- and Irt-like protein 1 (hZIP1) expression may be an indicator of good prognosis in clear cell renal cell carcinoma (ccRCC).
24488210 Data indicate that zinc transporters ZnT1 and Zip1 were the most abundantly expressed zinc transporters in leukocytes.
23921484 Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls.
23839533 Data indicate that the expression levels of ZnT and ZIP families in the three cell lines, when treated with high concentration of ZnSO4, increased and decreased corresponding to their functions, respectively.
22349685 The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease.
21360563 RREB-1 overexpression results in down-regulation of hZIP1 and contributes to the loss of hZIP1 expression and zinc in prostate cancer.
21103883 Differentiated Caco-2 cells tolerate significantly higher levels of zinc compared to undifferentiated Caco-2 cells, which was accompanied by upregulated ZnT-1 and downregulated ZIP1 levels.
21053094 The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients.
More...

AA Sequence

MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALS      1 - 70
LVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPS     71 - 140
PLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMEL    141 - 210
CLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAA    211 - 280
GTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI                              281 - 324
//

Text Mined References (34)

PMID Year Title
26081940 2015 Persistent low expression of hZip1 in mucinous carcinomas of the ovary, colon, stomach and lung.
24922175 2014 Zinc fortification decreases ZIP1 gene expression of some adolescent females with appropriate plasma zinc levels.
24878177 2014 hZIP1 that is down-regulated in clear cell renal cell carcinoma is negatively associated with the malignant potential of the tumor.
24488210 2014 The alteration of zinc transporter gene expression is associated with inflammatory markers in obese women.
23921484 2013 Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature.
23839533 2013 Effects of exogenous zinc on cell cycle, apoptosis and viability of MDAMB231, HepG2 and 293 T cells.
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
21360563 2011 hZIP1 zinc transporter down-regulation in prostate cancer involves the overexpression of ras responsive element binding protein-1 (RREB-1).
21269460 2011 Initial characterization of the human central proteome.
More...