Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 8
Funding $1,318,758.75
PubMed Score 39.21
PubTator Score 26.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24465901 Concordant overexpression of MDL-1 and DAP12 were correlated with increased production of proinflammatory cytokines in rheumatoid arthritis patients.
23152543 Blockade of CLEC5A inhibits NLRP3 inflammasome activation and pyrotopsis in dengue-virus-infected inflammatory macrophages. Thus, DV can activate NLRP3 inflammasome via CLEC5A.
22536019 No significant associations were noted between the genotypes and allele frequency of the 4 CLEC5A tSNPs between controls and Kawasaki disease patients.
21566123 CLEC5A is homodimeric at the cell surface and binds to dengue virus serotypes 1-4.
21094529 CLEC5A expression in monocyte/macrophage and granulocytes is regulated by PU.1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20057064 The crystal volume per unit weight (VM) was calculated to be 2.34 A3 Da-1, with nine molecules per asymmetric unit and a solvent content of 47.38%. CLEC5A plays an important role in the pathophysiology of dengue-virus-induced disease.
18496526 blockade of CLEC5A-mediated signalling attenuates the production of proinflammatory cytokines by macrophages infected with Dengue virus (either alone or complexed with an enhancing antibody)

AA Sequence

MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTV      1 - 70
CPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRW     71 - 140
RWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK                          141 - 188
//

Text Mined References (16)

PMID Year Title
24465901 2014 A potential role of myeloid DAP12-associating lectin (MDL)-1 in the regulation of inflammation in rheumatoid arthritis patients.
23568457 2013 Genetic variants associated with disordered eating.
23152543 2013 CLEC5A is critical for dengue virus-induced inflammasome activation in human macrophages.
22536019 2012 Lack of association between CLEC5A gene single-nucleotide polymorphisms and Kawasaki disease in Taiwanese children.
21566123 2011 Structural flexibility of the macrophage dengue virus receptor CLEC5A: implications for ligand binding and signaling.
21094529 2011 CLEC5A (MDL-1) is a novel PU.1 transcriptional target during myeloid differentiation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20057064 2010 Crystallization and X-ray diffraction analysis of human CLEC5A (MDL-1), a dengue virus receptor.
18496526 2008 CLEC5A is critical for dengue-virus-induced lethal disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...