Property Summary

NCBI Gene PubMed Count 16
PubMed Score 39.21
PubTator Score 26.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Severe Dengue 3
Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.26343762892454E-12
lung carcinoma 2844 2.01457594778222E-7
pilocytic astrocytoma 3086 2.02750040987221E-6
tuberculosis and treatment for 6 months 686 2.93256974398432E-4
osteosarcoma 7933 4.47240099937819E-4
pediatric high grade glioma 2712 4.86272396641303E-4
cutaneous lupus erythematosus 1056 0.00147256855642951
atypical teratoid / rhabdoid tumor 4369 0.00158103922871596
glioblastoma 5572 0.00184924016092692
ductal carcinoma in situ 1745 0.00462877479440312
invasive ductal carcinoma 2950 0.00485020628048325
non primary Sjogren syndrome sicca 840 0.00669886576480131
interstitial cystitis 2299 0.0207166638693842
lung cancer 4473 0.0256535467723652
Disease Target Count Z-score Confidence
Dengue disease 19 4.625 2.3
Autoimmune neuropathy 6 3.892 1.9

Expression

Synonym

Accession Q9NY25 Q52M11 Q9UKQ0
Symbols MDL1
MDL-1
CLECSF5

Gene

PDB

2YHF  

Gene RIF (8)

PMID Text
24465901 Concordant overexpression of MDL-1 and DAP12 were correlated with increased production of proinflammatory cytokines in rheumatoid arthritis patients.
23152543 Blockade of CLEC5A inhibits NLRP3 inflammasome activation and pyrotopsis in dengue-virus-infected inflammatory macrophages. Thus, DV can activate NLRP3 inflammasome via CLEC5A.
22536019 No significant associations were noted between the genotypes and allele frequency of the 4 CLEC5A tSNPs between controls and Kawasaki disease patients.
21566123 CLEC5A is homodimeric at the cell surface and binds to dengue virus serotypes 1-4.
21094529 CLEC5A expression in monocyte/macrophage and granulocytes is regulated by PU.1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20057064 The crystal volume per unit weight (VM) was calculated to be 2.34 A3 Da-1, with nine molecules per asymmetric unit and a solvent content of 47.38%. CLEC5A plays an important role in the pathophysiology of dengue-virus-induced disease.
18496526 blockade of CLEC5A-mediated signalling attenuates the production of proinflammatory cytokines by macrophages infected with Dengue virus (either alone or complexed with an enhancing antibody)

AA Sequence

MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTV      1 - 70
CPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRW     71 - 140
RWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK                          141 - 188
//

Text Mined References (16)

PMID Year Title
24465901 2014 A potential role of myeloid DAP12-associating lectin (MDL)-1 in the regulation of inflammation in rheumatoid arthritis patients.
23568457 2013 Genetic variants associated with disordered eating.
23152543 2013 CLEC5A is critical for dengue virus-induced inflammasome activation in human macrophages.
22536019 2012 Lack of association between CLEC5A gene single-nucleotide polymorphisms and Kawasaki disease in Taiwanese children.
21566123 2011 Structural flexibility of the macrophage dengue virus receptor CLEC5A: implications for ligand binding and signaling.
21094529 2011 CLEC5A (MDL-1) is a novel PU.1 transcriptional target during myeloid differentiation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20057064 2010 Crystallization and X-ray diffraction analysis of human CLEC5A (MDL-1), a dengue virus receptor.
18496526 2008 CLEC5A is critical for dengue-virus-induced lethal disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...