Property Summary

NCBI Gene PubMed Count 26
PubMed Score 2.70
PubTator Score 18.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.200 2.6e-03
group 3 medulloblastoma 1.200 2.4e-03
lung cancer 1.600 1.9e-03
Multiple myeloma 1.242 1.4e-03
ovarian cancer 1.400 8.3e-03
Waldenstrons macroglobulinemia 1.409 7.8e-03

Gene RIF (6)

AA Sequence

MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERV      1 - 70
VLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKK     71 - 140
LQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGG    141 - 210
GFRGRGH                                                                   211 - 217
//

Text Mined References (29)

PMID Year Title