Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
R01 Count 2
Funding $966,011
PubMed Score 95.28
PubTator Score 37.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 3.032 0.000
colon cancer 2.700 0.004
lung cancer -1.600 0.006
group 3 medulloblastoma 1.900 0.004

Gene RIF (10)

PMID Text
26240276 HAGE expression is a potential prognostic marker and a predictor of response to anthracycline treatment in triple negative breast cancer.
24899684 DDX43 induces RAS protein expression and signaling, mediating a novel mechanism of MEK inhibitor resistance.
24656837 DDX43 gene is activated by promoter hypomethylation and DDX43 hypomethylation may be a favorable prognostic factor in acute myeloid leukemia.
24525737 Suggest that the helicase HAGE has a key role in the resistance of ABCB5+ malignant melanoma stem cells to IFNalpha treatment by promoting SOCS1 expression.
23495895 data suggest that hypomethylation of the DDX43 promoter may be an early and frequent molecular event in the development of CML in Chinese patients
22563673 DDX43 promoter in frequently hypomethylated in myelodysplastic syndrome and is associated with favourable outcome.
22393060 the helicase HAGE is required for ABCB5+ MMIC-dependent tumor growth through promoting RAS protein expression
22040965 HAGE cDNA expression is relevant to specific subtypes of acute myeloid leukemiaand to the progression of chronic myeloid leukemia.
20058853 HAGE protein expression was confirmed in 75% (12/16) of carcinomas as compared to normal tissues
17487488 HAGE is a cancer/testis antigen with potential for melanoma immunotherapy

AA Sequence

MSHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPL      1 - 70
CFALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYN     71 - 140
SECGIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSK    141 - 210
VEADSWRKENFNITWDDLKDGEKRPIPNPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGI    211 - 280
DLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVY    281 - 350
GGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPD    351 - 420
RQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKV    421 - 490
IVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVY    491 - 560
NFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQK    561 - 630
REMERKMERPQGRPKKFH                                                        631 - 648
//

Text Mined References (22)

PMID Year Title
26240276 2016 HAGE in Triple-Negative Breast Cancer Is a Novel Prognostic, Predictive, and Actionable Biomarker: A Transcriptomic and Protein Expression Analysis.
24899684 2014 Overexpression of DDX43 mediates MEK inhibitor resistance through RAS Upregulation in uveal melanoma cells.
24656837 2014 DDX43 promoter is frequently hypomethylated and may predict a favorable outcome in acute myeloid leukemia.
24525737 2014 The helicase HAGE prevents interferon-?-induced PML expression in ABCB5+ malignant melanoma-initiating cells by promoting the expression of SOCS1.
23495895 2013 The methylation status of the DDX43 promoter in Chinese patients with chronic myeloid leukemia.
22563673 2012 Aberrant hypomethylation of DDX43 promoter in myelodysplastic syndrome.
22393060 2012 The helicase HAGE expressed by malignant melanoma-initiating cells is required for tumor cell proliferation in vivo.
22040965 2011 Gene expression of helicase antigen in patients with acute and chronic myeloid leukemia.
20058853 2010 HAGE, a cancer/testis antigen expressed at the protein level in a variety of cancers.
17487488 2007 HAGE, a cancer/testis antigen with potential for melanoma immunotherapy: identification of several MHC class I/II HAGE-derived immunogenic peptides.
More...