Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
acute quadriplegic myopathy 1157 2.50594877265669E-8
malignant mesothelioma 3163 6.65695054516904E-8
osteosarcoma 7933 2.71596544130843E-6
atypical teratoid/rhabdoid tumor 1095 4.9631623033582E-6
tuberculosis 1563 5.53667620685588E-6
ependymoma 2514 2.83647707353316E-5
psoriasis 6685 1.3016845970884E-4
group 3 medulloblastoma 2254 2.89685487095049E-4
ovarian cancer 8492 5.97425116001569E-4
medulloblastoma, large-cell 6234 0.00199759396746846
primitive neuroectodermal tumor 3031 0.00291446298918331
Breast cancer 3099 0.0313652167910565


  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis -1.600 0.000
osteosarcoma -2.236 0.000
ependymoma 1.100 0.000
group 3 medulloblastoma 1.700 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.100 0.002
primitive neuroectodermal tumor 1.200 0.003
acute quadriplegic myopathy 1.003 0.000
tuberculosis 1.200 0.000
Breast cancer 2.400 0.031
ovarian cancer 1.800 0.001


Accession Q9NXX6 Q5SQQ5 Q6P673 Q8WY66 Q9BS90 NS4EA
Symbols NS4EA


  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (1)

25590999 TRIM31 directly binds to NSE4, suggesting the existence of a TRIM31-MAGEA1-NSE4 complex reminiscent of the NSE1-NSE3-NSE4 trimer.

AA Sequence

GIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA                                       351 - 385

Text Mined References (15)

PMID Year Title
25590999 2015 The melanoma-associated antigen 1 (MAGEA1) protein stimulates the E3 ubiquitin-ligase activity of TRIM31 within a TRIM31-MAGEA1-NSE4 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15752197 2005 Qri2/Nse4, a component of the essential Smc5/6 DNA repair complex.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.