Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.003 2.5e-08
atypical teratoid / rhabdoid tumor 1.100 9.9e-04
Breast cancer 2.400 3.1e-02
ependymoma 1.100 2.8e-05
group 3 medulloblastoma 1.500 9.9e-05
malignant mesothelioma 1.800 6.7e-08
medulloblastoma, large-cell 1.100 2.0e-03
osteosarcoma -2.236 2.7e-06
ovarian cancer 1.800 6.0e-04
primitive neuroectodermal tumor 1.200 2.9e-03
psoriasis -1.600 1.3e-04
tuberculosis 1.200 5.5e-06

Gene RIF (1)

AA Sequence

MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEPSDSGDEMMDP      1 - 70
ASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTLFNEVSRAREAVLDAHFLVLA     71 - 140
SDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENTFN    141 - 210
KTHTFHFLLGSIYGECPVPKPRVDRPRKVPVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFRE    211 - 280
DPDTPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQ    281 - 350
GIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA                                       351 - 385
//

Text Mined References (16)

PMID Year Title