Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.09
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.2e-05
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 3.933 2.0
Choroideremia 16 3.557 1.8
Fundus dystrophy 83 3.519 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.841 2.2e-05

 GO Function (1)

Gene RIF (5)

AA Sequence

MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHAT      1 - 70
HRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPD     71 - 140
KNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG    141 - 210
GFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV    211 - 280
GHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQSEGLLYRARYFGDTD    281 - 350
MYHRAQKMGTPSCSRLSEVQASLHG                                                 351 - 375
//

Text Mined References (19)

PMID Year Title