Property Summary

NCBI Gene PubMed Count 11
PubMed Score 43.12
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9NXV2 D3DU96
Symbols

Gene

PDB

3DRX   3DRY   3DRZ  

Gene RIF (4)

PMID Text
26188516 Identification of MCM7, ZNF711 and FAM193 as KCTD5 interaction partners.KCTD5 is not involved in polyubiquitylation of MCM7 replication factor.The KCTD5/cullin3 complex stabilizes ZNF711 transcription factor.
19361449 structure reveals assemblies of five subunits while tetramers were anticipated; pentameric stoichiometry is observed also in solution by scanning transmission electron microscopy mass analysis and analytical ultracentrifugation
18573101 Analysis of the interaction with cullin3 showed that, in addition to the BTB domain, some amino acids in the N-terminus of KCTD5 are required for binding to cullin3. Findings suggest that KCTD5 is a substrate-specific adaptor for cullin3-based E3 ligases
17239418 we have identified a novel cellular AAV-2 Rep78/Rep68 interaction partner, KCTD5, located predominantly in the cytoplasm.

AA Sequence

MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL      1 - 70
YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD     71 - 140
KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH    141 - 210
NTPYGTASEPSEKAKILQERGSRM                                                  211 - 234
//

Text Mined References (14)

PMID Year Title
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19361449 2009 Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
18573101 2008 KCTD5, a putative substrate adaptor for cullin3 ubiquitin ligases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17239418 2007 Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2).
16501559 2006 Analysis of the human protein interactome and comparison with yeast, worm and fly interaction datasets.
More...