Property Summary

NCBI Gene PubMed Count 13
PubMed Score 50.15
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ductal carcinoma in situ 1.100 2.0e-05
ependymoma 1.100 7.3e-06
glioblastoma 1.100 6.1e-10
group 3 medulloblastoma 1.100 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 3.5e-02
invasive ductal carcinoma 1.400 1.5e-04
osteosarcoma 1.157 2.4e-02
pediatric high grade glioma 1.100 7.4e-07
Polycystic ovary syndrome -1.029 1.2e-02
primary pancreatic ductal adenocarcinoma 1.059 1.5e-02
primitive neuroectodermal tumor 1.100 1.4e-04
psoriasis 1.400 1.2e-04

Gene RIF (5)

AA Sequence

MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL      1 - 70
YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD     71 - 140
KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH    141 - 210
NTPYGTASEPSEKAKILQERGSRM                                                  211 - 234
//

Text Mined References (16)

PMID Year Title