Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.79
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 1.4e-02
astrocytic glioma -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -2.200 1.5e-05
Duchenne muscular dystrophy 1.225 1.8e-06
ependymoma -1.200 7.3e-04
glioblastoma -2.000 1.5e-04
group 4 medulloblastoma -1.500 2.1e-02
juvenile dermatomyositis 1.060 8.6e-08
malignant mesothelioma -1.600 3.8e-07
medulloblastoma, large-cell -2.700 3.2e-04
ovarian cancer -1.500 5.0e-08
pancreatic cancer 1.600 6.2e-03
primary pancreatic ductal adenocarcinoma 1.749 2.9e-03
primitive neuroectodermal tumor -1.400 2.9e-02
psoriasis -1.800 1.4e-04
Rheumatoid arthritis 1.400 9.1e-03
subependymal giant cell astrocytoma 1.858 1.1e-02

Synonym

Accession Q9NXU5 Q6IAD0
Symbols ARFRP2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (7)

AA Sequence

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKA      1 - 70
VPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLIL     71 - 140
ANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM          141 - 204
//

Text Mined References (22)

PMID Year Title