Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.53
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.99389332573703E-8
juvenile dermatomyositis 1189 8.64171328041776E-8
malignant mesothelioma 3163 3.84173743776377E-7
Duchenne muscular dystrophy 602 1.84399254505652E-6
atypical teratoid / rhabdoid tumor 4369 1.53370123909075E-5
psoriasis 6685 1.39693145945493E-4
glioblastoma 5572 1.50483191736209E-4
medulloblastoma, large-cell 6234 3.20450648690258E-4
ependymoma 2514 7.3174734624747E-4
astrocytic glioma 2241 0.00133964705566101
primary pancreatic ductal adenocarcinoma 1271 0.00286580344040824
pancreatic cancer 2300 0.00621209143842705
Rheumatoid Arthritis 1171 0.0091173619350641
subependymal giant cell astrocytoma 2287 0.0105322569016031
adult high grade glioma 2148 0.013630558068312
medulloblastoma 1524 0.0191661061190351
primitive neuroectodermal tumor 3031 0.0286612403136189
Disease Target Count Z-score Confidence
Disease of metabolism 15 0.0 2.0
Parkinson's disease 364 0.0 2.0

Expression

  Differential Expression (17)

Synonym

Accession Q9NXU5 Q6IAD0
Symbols ARFRP2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
26722494 These findings indicated that there may be a racial/ethnic- and/or sex-specific association of the ARL15 rs6450176 single nucleotide polymorphism and serum lipid levels.
24688318 The SNPs in ADP-ribosylation factor-like protein 15 (ARL15) and the T-cadherin (CDH13) genes did not exhibit significant association with individual metabolic traits in the T2DM and NDM groups.
23918589 In this first GWAS of rheumatoid arthritis among North Indians, ARL15 emerged as a novel genetic risk factor in addition to the classic HLA locus.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20011104 findings identify a novel protein, ARL15, which influences circulating adiponectin levels and may impact upon CHD risk
20011104 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKA      1 - 70
VPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLIL     71 - 140
ANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM          141 - 204
//

Text Mined References (21)

PMID Year Title
26722494 2015 Association of the ARL15 rs6450176 SNP and serum lipid levels in the Jing and Han populations.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24688318 2014 Association study of ARL15 and CDH13 with T2DM in a Han Chinese population.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23918589 2013 A genome-wide association study reveals ARL15, a novel non-HLA susceptibility gene for rheumatoid arthritis in North Indians.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
More...