Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.06665291464679E-7
primitive neuroectodermal tumor 3031 3.12228902738697E-5
glioblastoma 5572 4.72577538579155E-5
medulloblastoma 1524 1.3130638375117E-4
medulloblastoma, large-cell 6234 1.64698678677321E-4
osteosarcoma 7933 0.00129490626558261

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.080 0.001
medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000

Synonym

Accession Q9NXT0 A0JLV8 A8MY63 B3KTS9 E7ERT1 G3XAH3
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

AA Sequence

MAAAAALRAPAQSSVTFEDVAVNFSLEEWSLLNEAQRCLYRDVMLETLTLISSLGCWHGGEDEAAPSKQS      1 - 70
TCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTGERPYECSKYGKLFHQKPTLHIH     71 - 140
ERFHTGQKTYECSECGKSFHQSSSLLQRQTLHTRERPYECIECGKAFAEKSSLINHRKVHSGAKRYECNE    141 - 210
CGKSFAYTSSLIKHRRIHTGERPYECSECGRSFAENSSLIKHLRVHTGERPYECVECGKSFRRSSSLLQH    211 - 280
QRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCGKSFSRKSSLIIHLRVHTGERPYECSDC    281 - 350
GKSFAENSSLIKHLRVHTGERPYECIDCGKSFRHSSSFRRHQRVHTGMRPYK                      351 - 402
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.