Property Summary

Ligand Count 10
NCBI Gene PubMed Count 12
PubMed Score 11.41
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.0e-04
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.196 3.0e-04

Gene RIF (2)

AA Sequence

MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRV      1 - 70
PLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTAS     71 - 140
TPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKK    141 - 210
QAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYS    211 - 280
HFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVW    281 - 350
HTPADTEVNLHPPTVHNLCRILAVFLAEYLGL                                          351 - 382
//

Text Mined References (17)

PMID Year Title