Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.01
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.95769992526562E-4
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.196 0.000

Synonym

Accession Q9NXS2 Q53HE4 Q96F74
Symbols gQC

Gene

PANTHER Protein Class (1)

PDB

3PB4   3PB6   3PB7   3PB8   3PB9  

  Ortholog (13)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
21953277 genetic association studies in Danish population: Quantitative metabolic phenotypes in obesity are associated with SNP in various genes: QPCTL (rs2287019) is associated with body mass index and increased insulinogenic index.

AA Sequence

MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRV      1 - 70
PLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTAS     71 - 140
TPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKK    141 - 210
QAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYS    211 - 280
HFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVW    281 - 350
HTPADTEVNLHPPTVHNLCRILAVFLAEYLGL                                          351 - 382
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21953277 2012 Association studies of novel obesity-related gene variants with quantitative metabolic phenotypes in a population-based sample of 6,039 Danish individuals.
21288892 2011 Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19946888 2010 Defining the membrane proteome of NK cells.
18486145 2008 Isolation of an isoenzyme of human glutaminyl cyclase: retention in the Golgi complex suggests involvement in the protein maturation machinery.
More...