Property Summary

NCBI Gene PubMed Count 23
Grant Count 9
R01 Count 6
Funding $339,845.66
PubMed Score 191.16
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.422 0.002
malignant mesothelioma 1.100 0.000
glioblastoma 1.800 0.000
osteosarcoma -1.895 0.000
posterior fossa group A ependymoma 1.200 0.000
medulloblastoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 1.100 0.005
primitive neuroectodermal tumor 1.700 0.000
non-small cell lung cancer -1.160 0.000
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.200 0.000
lung adenocarcinoma -1.100 0.000
Breast cancer -1.400 0.000
ovarian cancer -1.800 0.000
dermatomyositis 1.800 0.000

Gene RIF (9)

PMID Text
25819753 ING3 levels may serve as a surrogate for growth rate, and suggest possible roles for ING3 in growth and self renewal and related diseases such as cancer.
24927342 Downregulated ING3 expression might play an important role in colorectal adenoma-adenocarcinoma sequence.
22550337 that ING3 may be an important marker for human hepatocellular carcinoma progression and prognosis, as well as a potential therapeutic target.
19935701 Data show that ING3 is degraded by the ubiquitin-proteasome pathway through the SCF(Skp2) complex.
19401682 Observational study of gene-disease association. (HuGE Navigator)
18081876 ING3 would function as a potential tumor suppressor molecule and that low levels of ING3 may indicate an aggressive nature of head and neck cancer.
17634537 ING3 may be an important marker for human melanoma progression and prognosis as well as a potential therapeutic target.
12545155 we have isolated a novel ING family gene, p47ING3, which modulates p53-mediated transcription, cell cycle control, and apoptosis. The p47ING3 gene is located at chromosome 7q31.3 and consists of 12 exons that encode 418 amino acids
12080476 Allelic loss and reduced expression of the ING3, a candidate tumor suppressor gene at 7q31, in human head and neck cancers.

AA Sequence

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYY      1 - 70
KALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHS     71 - 140
HTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGS    141 - 210
YNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSA    211 - 280
LMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQ    281 - 350
VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK      351 - 418
//

Text Mined References (27)

PMID Year Title
25819753 2015 ING3 protein expression profiling in normal human tissues suggest its role in cellular growth and self-renewal.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24927342 2014 Downregulated inhibitor of growth 3 (ING3) expression during colorectal carcinogenesis.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
22550337 2012 Expression and prognostic value of ING3 in human primary hepatocellular carcinoma.
19935701 2010 The tumor suppressor ING3 is degraded by SCF(Skp2)-mediated ubiquitin-proteasome system.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19154204 2009 Arabidopsis ING and Alfin1-like protein families localize to the nucleus and bind to H3K4me3/2 via plant homeodomain fingers.
More...