Property Summary

NCBI Gene PubMed Count 25
PubMed Score 199.37
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.700 1.1e-04
Astrocytoma, Pilocytic 1.200 1.4e-06
atypical teratoid / rhabdoid tumor 1.600 2.9e-07
Breast cancer -1.400 5.4e-11
dermatomyositis 1.800 8.9e-05
ependymoma 1.100 3.1e-09
glioblastoma 1.500 5.3e-06
group 3 medulloblastoma 1.100 2.3e-02
lung adenocarcinoma -1.100 1.9e-11
malignant mesothelioma 1.100 2.3e-06
medulloblastoma, large-cell 1.100 4.6e-03
Multiple myeloma 1.422 2.3e-03
non-small cell lung cancer -1.160 1.0e-20
osteosarcoma -1.895 5.7e-08
ovarian cancer -1.800 9.4e-10
primitive neuroectodermal tumor 1.700 9.7e-05

Gene RIF (11)

AA Sequence

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYY      1 - 70
KALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHS     71 - 140
HTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGS    141 - 210
YNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSA    211 - 280
LMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQ    281 - 350
VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK      351 - 418
//

Text Mined References (30)

PMID Year Title