Property Summary

NCBI Gene PubMed Count 32
Grant Count 18
R01 Count 14
Funding $949,912.75
PubMed Score 193.74
PubTator Score 23.03

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.057 0.000
adrenocortical carcinoma -1.642 0.000
tuberculosis 1.700 0.000
ovarian cancer 1.200 0.001

 GWAS Trait (1)

Gene RIF (11)

22555662 High BRE and high EVI1 expression are mutually exclusive in MLL-AF9-positive acute myeloid leukemia patients.
21937695 High BRE expression defines a novel subtype of adult acute myeloid leukemia characterized by a favorable prognosis.
21282113 NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes
20861917 overexpression of the BRE gene is predominantly found in MLL-rearranged AML with t(9;11)(p22;q23).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20035718 These results show that BRE over-expression can indeed promote growth, though not initiation, of liver tumors.
19757177 A novel stress-responsive gene called BRE which interacts with TNF-receptor-1 and blocks the apoptotic effect of TNF-alpha, was identified.
18756325 results implied that BRE plays a significant role in mediating antiapoptotic and proliferative responses in esophageal carcinoma cells
17704801 Antiapoptotic in vivo; Bre levels are regulated post-transcriptionally in the liver, which is not observed in human hepatocellular carcinoma (HCC) and non-HCC cell lines.
15582573 the enhanced tumor growth is more likely due to the antiapoptotic activity of BRE than any direct effect of the protein on cell proliferation

AA Sequence

PRWDGNEMAKRAKAYFKTFVPQFQEAAFANGKL                                         351 - 383

Publication (41)

PMID Year Title
26195665 2015 The deubiquitinating enzyme complex BRISC is required for proper mitotic spindle assembly in mammalian cells.
25283148 2014 ABRO1 suppresses tumourigenesis and regulates the DNA damage response by stabilizing p53.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22555662 2012 Improved classification of MLL-AF9-positive acute myeloid leukemia patients based on BRE and EVI1 expression.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21937695 2011 High BRE expression predicts favorable outcome in adult acute myeloid leukemia, in particular among MLL-AF9-positive patients.