Property Summary

NCBI Gene PubMed Count 42
Grant Count 65
R01 Count 47
Funding $6,307,735.26
PubMed Score 90.52
PubTator Score 46.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NXR1 Q49AQ2 NudE
Symbols NDE
LIS4
MHAC
NUDE
NUDE1
HOM-TES-87

Gene

 GO Function (1)

Gene RIF (25)

PMID Text
26350705 Interaction between NDE1 and high birth weight was associated with increased susceptibility to schizophrenia.
26206584 These data show that cell cycle-dependent mechanisms can control ciliary length through a CDK5-FBW7-NDE1 pathway.
25332407 study strengthens the evidence for association between rare variants within NDE1 and schizophrenia, and may shed light into the molecular mechanisms underlying this severe psychiatric disorder.
24785679 study provided comprehensive documentation of the expression patterns of Nde1 and Ndel1 in cultured cells as well as in mouse and human brains, and also highlighting that dosage effects of these two proteins might contribute to some cases of mental disorder
23704059 Description of a severe microcephaly syndrome where an autosomal recessive condition combines an inherited segmental duplication mediated deletion with a mutation in the NDE1 gene within the non-deleted homolog.
22843697 analysis of mixed NDE1-NDEL1 complexes demonstrates that NDE1 and NDEL1 can interact directly.
22526350 In three related patients with microhydranencephaly, a homozygous deletion that encompasses NDE1 exon 2 containing the initiation codon was identified.
21911489 Mutually exclusive cytoplasmic dynein regulation by NudE-Lis1 and dynactin.
21529752 NDE1 deficiency causes both a severe failure of neurogenesis and a deficiency in cortical lamination
21529751 NDE1 mutations cause a severe microlissencephaly syndrome. Patient's NDE1 proteins are unstable, cannot bind cytoplasmic dynein, and do not localize properly to the centrosome.
More...

AA Sequence

MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR      1 - 70
LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ     71 - 140
RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG    141 - 210
SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD    211 - 280
QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLGKRLEFGKPPSHMSSSPLPSAQGVVKMLL        281 - 346
//

Publication (48)

PMID Year Title
26350705 2015 An interaction between NDE1 and high birth weight increases schizophrenia susceptibility.
26206584 2015 Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length.
25332407 2015 Identification of Rare, Single-Nucleotide Mutations in NDE1 and Their Contributions to Schizophrenia Susceptibility.
24785679 2014 The expression and roles of Nde1 and Ndel1 in the adult mammalian central nervous system.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704059 2013 Deletion 16p13.11 uncovers NDE1 mutations on the non-deleted homolog and extends the spectrum of severe microcephaly to include fetal brain disruption.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843697 2012 The mitosis and neurodevelopment proteins NDE1 and NDEL1 form dimers, tetramers, and polymers with a folded back structure in solution.
22526350 2012 Novel NDE1 homozygous mutation resulting in microhydranencephaly and not microlyssencephaly.
More...