Property Summary

NCBI Gene PubMed Count 45
PubMed Score 96.04
PubTator Score 46.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lissencephaly 69 6.449 3.2
MICROHYDRANENCEPHALY 1 0.0 0.0

Expression

  Differential Expression (12)

Gene RIF (28)

AA Sequence

MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR      1 - 70
LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ     71 - 140
RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG    141 - 210
SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD    211 - 280
QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLGKRLEFGKPPSHMSSSPLPSAQGVVKMLL        281 - 346
//

Text Mined References (51)

PMID Year Title