Property Summary

NCBI Gene PubMed Count 6
PubMed Score 89.98
PubTator Score 21.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
group 3 medulloblastoma 2254 9.04670483546034E-5
hepatocellular carcinoma 550 2.09903202893859E-4
psoriasis 6685 0.00259805100314719
tuberculosis and treatment for 6 months 686 0.00379175807937407
ovarian cancer 8492 0.00752883607412224
progressive supranuclear palsy 674 0.00791886657300657

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
psoriasis 1.400 0.003
tuberculosis and treatment for 6 months -1.300 0.004
group 3 medulloblastoma 1.200 0.000
progressive supranuclear palsy -1.100 0.008
ovarian cancer 1.400 0.008

Synonym

Accession Q9NXP7 B2RXF7 B4DIV4 Q6AI03 Q96BR2 GIN-1
Symbols GIN-1
TGIN1
ZH2C2

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVRSGKNGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEK      1 - 70
KKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPW     71 - 140
SLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEF    141 - 210
IQQINIELYRLFGIKQIVISHTSGTVNPTESTPNTIKAFLSKHCADHPNNWDDHLSAVSFAFNVTHLEPT    211 - 280
KNTPYFQMFSRNPYMPETSDSLHEVDGDNTSMFAKILDAIKEADKIMENKTTSLGQMENNNLDELNKSKI    281 - 350
IVKKKPKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSH    351 - 420
LKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGAYQANILVEDATIGIVDNELLTSSKDRELLEYRN    421 - 490
TKISPLIDDHSSLEKQTFSLLDSSNQVLEYLS                                          491 - 522
//

Text Mined References (11)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470852 2001 A mammalian gene evolved from the integrase domain of an LTR retrotransposon.
More...