Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $1,199,907
PubMed Score 89.98
PubTator Score 21.18

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
psoriasis 1.400 0.003
tuberculosis and treatment for 6 months -1.300 0.004
group 3 medulloblastoma 1.200 0.000
progressive supranuclear palsy -1.100 0.008
ovarian cancer 1.400 0.008

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

TKISPLIDDHSSLEKQTFSLLDSSNQVLEYLS                                          491 - 522

Text Mined References (11)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470852 2001 A mammalian gene evolved from the integrase domain of an LTR retrotransposon.