Property Summary

NCBI Gene PubMed Count 6
PubMed Score 45.51
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9NXN4 Q96DZ0
Symbols MACROD3

Gene

PDB

4UML  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MDPLGAPSQFVDVDTLPSWGDSCQDELNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTA      1 - 70
IVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTA     71 - 140
AESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRFLEIHGETIEKVVFAVSDL    141 - 210
EEGTYQKLLPLYFPRSLKEENRSLPYLPADIGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLS    211 - 280
FIGSHAFARMEGDIDKQRKLILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGR    281 - 350
TVMVVVGRNIPVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRN    351 - 420
LKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYDARENGPYYTS    421 - 490
YPPSPDL                                                                   491 - 497
//

Text Mined References (10)

PMID Year Title