Property Summary

NCBI Gene PubMed Count 6
PubMed Score 45.51
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MDPLGAPSQFVDVDTLPSWGDSCQDELNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTA      1 - 70
IVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTA     71 - 140
AESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRFLEIHGETIEKVVFAVSDL    141 - 210
EEGTYQKLLPLYFPRSLKEENRSLPYLPADIGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLS    211 - 280
FIGSHAFARMEGDIDKQRKLILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGR    281 - 350
TVMVVVGRNIPVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRN    351 - 420
LKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYDARENGPYYTS    421 - 490
YPPSPDL                                                                   491 - 497
//

Text Mined References (10)

PMID Year Title