Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.49
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.488 0.000
lung cancer -1.100 0.010
Breast cancer 2.200 0.039
group 3 medulloblastoma 1.200 0.001
aldosterone-producing adenoma -1.160 0.010
ovarian cancer 1.200 0.011

Synonym

Accession Q9NXL9 B4DR30 B9DI77 Q2KHJ0 Q8N5S5 Q9HCV5 hMCM9
Symbols ODG4
MCMDC1
C6orf61
dJ329L24.1
dJ329L24.3

Gene

Gene RIF (7)

PMID Text
26300262 MCM9 loading onto chromatin is MSH2-dependent, and in turn MCM9 stimulates the recruitment of MLH1 to chromatin, revealing a role for MCM9 and its helicase activity in DNA mismatch repair.
25480036 Autosomal-recessive variants in MCM9 cause a genomic-instability syndrome associated with hypergonadotropic hypogonadism and short stature.
23403237 A novel alternatively spliced variant of MCM9 is specifically induced after exposure to Mitomycin C. Expression is cell-cycle regulated and induced in S-phase.
23401855 Chromatin immunoprecipitation analysis using human DR-GFP cells demonstrated that MCM8 and MCM9 proteins are rapidly recruited to DNA damage sites and promote RAD51 recruitment.
18657502 Cdt1, with its two opposing regulatory binding factors MCM9 and geminin, appears to be a major platform on the pre-replication complexes to integrate cell-cycle signals.
16226853 We also show that the very recently reported human MCM9 protein (HsMCM9), which resembles a truncated MCM-like protein missing a part of the MCM2-7 signature domain, is an incomplete form of the full length HsMCM9 described here.
15850810 Identified a novel MCM family gene, MCM9, by using bioinformatics; mouse MCM9 mRNA was upregulated by transcription factor E2E1 and serum stimulation in NIH3T3 cells.

AA Sequence

MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFD      1 - 70
SALRRSALTILQSLSQPEAVSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLE     71 - 140
FERDYMCNKCKHVFVIKADFEQYYTFCRPSSCPSLESCDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQR    141 - 210
LSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQVNNEQSSGIIM    211 - 280
DEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLL    281 - 350
VGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK    351 - 420
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLL    421 - 490
DTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQPTLSDVGNQVLLRYYQMQRQSDCRN    491 - 560
AARTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPGEQYQR    561 - 630
QCELILEKLELQSLLSEELRRLERLQNQSVHQSQPRVLEVETTPGSLRNGPGEESNFRTSSQQEINYSTH    631 - 700
IFSPGGSPEGSPVLDPPPHLEPNRSTSRKHSAQHKNNRDDSLDWFDFMATHQSEPKNTVVVSPHPKTSGE    701 - 770
NMASKISNSTSQGKEKSEPGQRSKVDIGLLPSPGETGVPWRADNVESNKKKRLALDSEAAVSADKPDSVL    771 - 840
THHVPRNLQKLCKERAQKLCRNSTRVPAQCTVPSHPQSTPVHSPDRMLDSPKRKRPKSLAQVEEPAIENV    841 - 910
KPPGSPVAKLAKFTFKQKSKLIHSFEDHSHVSPGATKIAVHSPKISQRRTRRDAALPVKRPGKLTSTPGN    911 - 980
QISSQPQGETKEVSQQPPEKHGPREKVMCAPEKRIIQPELELGNETGCAHLTCEGDKKEEVSGSNKSGKV    981 - 1050
HACTLARLANFCFTPPSESKSKSPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESL   1051 - 1120
FTLPELGDEAFDCDWDEEMRKKS                                                  1121 - 1143
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26300262 2015 MCM9 Is Required for Mammalian DNA Mismatch Repair.
25480036 2014 MCM9 mutations are associated with ovarian failure, short stature, and chromosomal instability.
23403237 2013 Identification, quantification, and evolutionary analysis of a novel isoform of MCM9.
23401855 2013 The MCM8-MCM9 complex promotes RAD51 recruitment at DNA damage sites to facilitate homologous recombination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22771115 2012 Mcm8 and Mcm9 form a complex that functions in homologous recombination repair induced by DNA interstrand crosslinks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19342892 2009 How to load a replicative helicase onto chromatin: a more and more complex matter during evolution.
19292915 2009 Ancient diversification of eukaryotic MCM DNA replication proteins.
More...