Property Summary

NCBI Gene PubMed Count 10
PubMed Score 35.21
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count P-value
lung carcinoma 2844 6.38988234842874E-20
medulloblastoma 1524 1.59115799770932E-11
atypical teratoid / rhabdoid tumor 4369 3.35579138333304E-10
pilocytic astrocytoma 3086 1.79381457890722E-6
pediatric high grade glioma 2712 2.58407201348293E-6
glioblastoma 5572 6.27511314110345E-6
medulloblastoma, large-cell 6234 1.43173978776836E-5
cutaneous lupus erythematosus 1056 9.30659794567266E-4
osteosarcoma 7933 0.00138186035119195
invasive ductal carcinoma 2950 0.00156147176097638
primitive neuroectodermal tumor 3031 0.00169100359524811
lung cancer 4473 0.00171994252530293
subependymal giant cell astrocytoma 2287 0.00367396061884053
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00566663086204457
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0139628079068496
Endometriosis 535 0.0240346492316376
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.030380853197883
urothelial carcinoma 318 0.0321586255313103
ductal carcinoma in situ 1745 0.0465438610045658
Disease Target Count Z-score Confidence
Dental caries 67 0.0 1.0
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Gas gangrene 15 3.136 1.6
Histoplasmosis 22 3.088 1.5

Expression

Synonym

Accession Q9NXL6 Q17RR4
Symbols SID1
SID-1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (3)

PMID Text
22509261 characterization of Sid-1 extracellular domain
22174421 SIDT1, facilitates rapid, contact-dependent, bidirectional small RNA transfer between human cells, resulting in target-specific non-cell-autonomous RNAi
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRGCLRLALLCALPWLLLAASPGHPAKSPRQPPAPRRDPFDAARGADFDHVYSGVVNLSTENIYSFNYTS      1 - 70
QPDQVTAVRVYVNSSSENLNYPVLVVVRQQKEVLSWQVPLLFQGLYQRSYNYQEVSRTLCPSEATNETGP     71 - 140
LQQLIFVDVASMAPLGAQYKLLVTKLKHFQLRTNVAFHFTASPSQPQYFLYKFPKDVDSVIIKVVSEMAY    141 - 210
PCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDFPGEQFFVVFVIKPEDYACGGSFFIQEK    211 - 280
ENQTWNLQRKKNLEVTIVPSIKESVYVKSSLFSVFIFLSFYLGCLLVGFVHYLRFQRKSIDGSFGSNDGS    281 - 350
GNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRT    351 - 420
KMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLG    421 - 490
VLSAFNNILSNLGHVLLGFLFLLIVLRRDILHRRALEAKDIFAVEYGIPKHFGLFYAMGIALMMEGVLSA    491 - 560
CYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVIMVTVLGVVFGKNDVWFWV    561 - 630
IFSAIHVLASLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLVVGNLVNWSFALF    631 - 700
GLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPVPLFCIVATAVMWAAALYFFFQNLSSWEG    701 - 770
TPAESREKNRECILLDFFDDHDIWHFLSATALFFSFLVLLTLDDDLDVVRRDQIPVF                 771 - 827
//

Text Mined References (12)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22509261 2012 Preparation and characterization of the extracellular domain of human Sid-1.
22174421 2012 Homo sapiens systemic RNA interference-defective-1 transmembrane family member 1 (SIDT1) protein mediates contact-dependent small RNA transfer and microRNA-21-driven chemoresistance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15850781 2005 RNA interference: a mammalian SID-1 homologue enhances siRNA uptake and gene silencing efficacy in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...