Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.98484921009516E-15

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -2.100 0.000

Synonym

Accession Q9NXL2 C9JIB4
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTP      1 - 70
QGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDSLFSN     71 - 140
IESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSILESYEKEEELKEH    141 - 210
LSHCIQSLKKIYMQEGKPNLLDMGSLMIKPIQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINV    211 - 280
NINELKRRKDLVLKYKKNDEDESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFR    281 - 350
ALEKTVRLCVKNISLCLQHIQDAMPLALQSVMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLIL    351 - 420
TPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEESDLAKKEYEALNAQLVEELQAFNQAARKILLN    421 - 490
CLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCVKENSATFIERKLSFEKKKPV    491 - 560
QILPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYDINLLEGDLVAVIEQKDPLGSTSRWLVDTGN    561 - 630
VKGYVYSSFLKPYNPAKMQKVDAENRFCDDDFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKF    631 - 700
ETNGTDVDSFQEVDEQIFYAVHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANY    701 - 770
LGKMTYA                                                                   771 - 777
//

Text Mined References (11)

PMID Year Title
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...