Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.45
PubTator Score 1.19

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASR      1 - 70
LHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAW     71 - 140
LHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVL    141 - 210
GCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLT    211 - 280
MPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM                            281 - 326
//

Text Mined References (18)

PMID Year Title