Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.97
PubTator Score 1.19

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26124079 FBXL12 plays a key role in the down-regulation of ALDH3 activity in trophoblast stem cells and thus initiates trophoblast differentiation during placental development.
23707388 Fbxl12-induced CaMKI degradation attenuates p27 phosphorylation at these sites in early G1 and iii) activation of CaMKI during G1 transition followed by p27 phosphorylation appears to be upstream to other p27 phosphorylation events

AA Sequence

MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASR      1 - 70
LHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAW     71 - 140
LHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVL    141 - 210
GCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLT    211 - 280
MPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM                            281 - 326
//

Publication (14)

PMID Year Title
26124079 2015 FBXL12-Mediated Degradation of ALDH3 is Essential for Trophoblast Differentiation During Placental Development.
25416956 2014 A proteome-scale map of the human interactome network.
23707388 2013 Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
18660753 2008 A new ubiquitin ligase involved in p57KIP2 proteolysis regulates osteoblast cell differentiation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
More...