Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.03
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.2

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease -1.148 3.4e-02
active ulcerative colitis -1.466 6.4e-03
lung adenocarcinoma -1.300 6.2e-13
lung cancer -1.600 2.7e-04
lung carcinoma -2.100 4.8e-24
non-small cell lung carcinoma -1.100 2.1e-19

Gene RIF (2)

AA Sequence

MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTAL      1 - 70
YMTDIKNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFP     71 - 140
DALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRLFLFPGE    141 - 210
SAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRK    211 - 280
EWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAALYRIPKPELHKKET                        281 - 330
//

Text Mined References (12)

PMID Year Title