Property Summary

NCBI Gene PubMed Count 16
PubMed Score 250.77
PubTator Score 52.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.7e-06
glioblastoma 1.300 4.2e-05
osteosarcoma -1.705 1.6e-06
psoriasis -1.600 3.5e-04
subependymal giant cell astrocytoma 2.056 9.6e-04

Synonym

Accession Q9NXJ5 A8K1Q3 Q8IVT1
Symbols PGI
PGP
Pcp
PGPI
PAP-I
PGP-I

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (7)

AA Sequence

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV      1 - 70
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI     71 - 140
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH     141 - 209
//

Text Mined References (18)

PMID Year Title