Property Summary

NCBI Gene PubMed Count 16
PubMed Score 239.82
PubTator Score 52.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pilocytic astrocytoma 3086 8.99684060466225E-7
osteosarcoma 7933 3.42816892426844E-5
glioblastoma 5572 4.21764659645518E-5
psoriasis 6685 3.49715272350716E-4
subependymal giant cell astrocytoma 2287 9.64270084714121E-4
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Cognitive disorder 44 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.849 0.000
glioblastoma 1.300 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 2.056 0.001

Synonym

Accession Q9NXJ5 A8K1Q3 Q8IVT1
Symbols PGI
PGP
Pcp
PGPI
PAP-I
PGP-I

Gene

PANTHER Protein Class (3)

  Ortholog (12)

Gene RIF (7)

PMID Text
26078706 cytosolic peptidases(puromycin-sensitive aminopeptidase (PSA), aminopeptidase B (APB) and pyroglutamyl-peptidase I (PGI) ) may be involved in colorectal carcinogenesis
25687677 The specific reduction of the levels of pyroglutamyl-aminopeptidase activity in serum of liver cirrhosis patients might be considered as a potential candidate to be included in a combination of markers for the diagnosis of this disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of pyroglutamyl-peptidase I (PGPEP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15380924 The activities of pyroglutamyl peptidase I and prolyl endopeptidase in necrozoospermia were found to be higher in the corresponding soluble and particulate sperm fractions, respectively, with respect to those measured in normozoospermic semen
15014037 VX-710 modulates Pgp, MRP-1, and BCRP(R482), and has potential as a clinical broad-spectrum multidrug resistance modulator in malignancies.
12651114 cloning and sequencing of the human (AJ278828) pyroglutamyl-peptidase I

AA Sequence

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV      1 - 70
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI     71 - 140
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH     141 - 209
//

Text Mined References (18)

PMID Year Title
26078706 2015 Altered Activity and Expression of Cytosolic Peptidases in Colorectal Cancer.
25687677 2015 Serum pyroglutamyl aminopeptidase activity: a promising novel biomarker candidate for liver cirrhosis.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380924 2004 Pyroglutamyl peptidase I and prolyl endopeptidase in human semen: increased activity in necrozoospermia.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15014037 2004 VX-710 (biricodar) increases drug retention and enhances chemosensitivity in resistant cells overexpressing P-glycoprotein, multidrug resistance protein, and breast cancer resistance protein.
More...