Property Summary

NCBI Gene PubMed Count 16
Grant Count 34
R01 Count 16
Funding $11,622,946.82
PubMed Score 239.82
PubTator Score 52.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.849 0.000
glioblastoma 1.300 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 2.056 0.001

Gene RIF (7)

PMID Text
26078706 cytosolic peptidases(puromycin-sensitive aminopeptidase (PSA), aminopeptidase B (APB) and pyroglutamyl-peptidase I (PGI) ) may be involved in colorectal carcinogenesis
25687677 The specific reduction of the levels of pyroglutamyl-aminopeptidase activity in serum of liver cirrhosis patients might be considered as a potential candidate to be included in a combination of markers for the diagnosis of this disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of pyroglutamyl-peptidase I (PGPEP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15380924 The activities of pyroglutamyl peptidase I and prolyl endopeptidase in necrozoospermia were found to be higher in the corresponding soluble and particulate sperm fractions, respectively, with respect to those measured in normozoospermic semen
15014037 VX-710 modulates Pgp, MRP-1, and BCRP(R482), and has potential as a clinical broad-spectrum multidrug resistance modulator in malignancies.
12651114 cloning and sequencing of the human (AJ278828) pyroglutamyl-peptidase I

AA Sequence

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV      1 - 70
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI     71 - 140
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH     141 - 209
//

Publication (18)

PMID Year Title
26078706 2015 Altered Activity and Expression of Cytosolic Peptidases in Colorectal Cancer.
25687677 2015 Serum pyroglutamyl aminopeptidase activity: a promising novel biomarker candidate for liver cirrhosis.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380924 2004 Pyroglutamyl peptidase I and prolyl endopeptidase in human semen: increased activity in necrozoospermia.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15014037 2004 VX-710 (biricodar) increases drug retention and enhances chemosensitivity in resistant cells overexpressing P-glycoprotein, multidrug resistance protein, and breast cancer resistance protein.
More...