Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 2.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
inflammatory breast cancer 404 4.32401915043565E-5
colon cancer 1475 1.66124570778224E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00127365249970271
diabetes mellitus 1663 0.00217554430421278
primary pancreatic ductal adenocarcinoma 1271 0.00673292072770137
pancreatic cancer 2300 0.00959709409431113
nephrosclerosis 329 0.0189496373550172
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.024479460557933
Disease Target Count Z-score Confidence
ulcerative colitis 2087 3.829 1.9
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Hartnup disease 13 4.128 2.1

Expression

Gene RIF (3)

PMID Text
24068945 Our results confirmed significant association to rare non-synonymous coding variants in both IL23R and CARD9, previously identified from sequencing of CD loci, as well as identified a novel association in RNF186
23896122 BNip1 functions as a downstream modulator of RNF186 to direct endoplasmic reticulum stress-associated apoptotic signaling.
23511034 Single-nucleotide polymorphism in RNF186 gene is associated with ulcerative colitis.

AA Sequence

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLL      1 - 70
LCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGED     71 - 140
GQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSS    141 - 210
RTLFCREQKHSHISSIA                                                         211 - 227
//

Text Mined References (10)

PMID Year Title
24068945 2013 Deep resequencing of GWAS loci identifies rare variants in CARD9, IL23R and RNF186 that are associated with ulcerative colitis.
23896122 2013 A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.