Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24068945 Our results confirmed significant association to rare non-synonymous coding variants in both IL23R and CARD9, previously identified from sequencing of CD loci, as well as identified a novel association in RNF186
23896122 BNip1 functions as a downstream modulator of RNF186 to direct endoplasmic reticulum stress-associated apoptotic signaling.
23511034 Single-nucleotide polymorphism in RNF186 gene is associated with ulcerative colitis.

AA Sequence

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLL      1 - 70
LCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGED     71 - 140
GQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSS    141 - 210
RTLFCREQKHSHISSIA                                                         211 - 227
//

Text Mined References (10)

PMID Year Title
24068945 2013 Deep resequencing of GWAS loci identifies rare variants in CARD9, IL23R and RNF186 that are associated with ulcerative colitis.
23896122 2013 A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.