1. Home
  2. Targets
  3. RING finger protein 186

Tdark RING finger protein 186


 Comments

Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 2.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
inflammatory breast cancer 404 4.32401915043565E-5
colon cancer 1475 1.66124570778224E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00127365249970271
diabetes mellitus 1663 0.00217554430421278
primary pancreatic ductal adenocarcinoma 1271 0.00673292072770137
pancreatic cancer 2300 0.00959709409431113
nephrosclerosis 329 0.0189496373550172
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.024479460557933
Disease Target Count Z-score Confidence
ulcerative colitis 2087 3.829 1.9
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Hartnup disease 13 4.128 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -1.361 0.019
primary pancreatic ductal adenocarcinoma -1.340 0.007
intraductal papillary-mucinous adenoma (... -2.100 0.001
intraductal papillary-mucinous carcinoma... -1.500 0.024
colon cancer -1.800 0.000
diabetes mellitus 1.300 0.002
inflammatory breast cancer -1.300 0.000
pancreatic cancer -1.300 0.010

Synonym

Accession Q9NXI6 Q53GE0
Symbols

Gene

RNF186

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (5)

 HCA RNA Cell Line (15)

See all...

Pathway (1)

 UniProt Keyword (9)

Gene RIF (3)

PMID Text
24068945 Our results confirmed significant association to rare non-synonymous coding variants in both IL23R and CARD9, previously identified from sequencing of CD loci, as well as identified a novel association in RNF186
23896122 BNip1 functions as a downstream modulator of RNF186 to direct endoplasmic reticulum stress-associated apoptotic signaling.
23511034 Single-nucleotide polymorphism in RNF186 gene is associated with ulcerative colitis.

AA Sequence 

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLL      1 - 70
LCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGED     71 - 140
GQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSS    141 - 210
RTLFCREQKHSHISSIA                                                         211 - 227
//

Text Mined References (10)

PMID Year Title
24068945 2013 Deep resequencing of GWAS loci identifies rare variants in CARD9, IL23R and RNF186 that are associated with ulcerative colitis.
23896122 2013 A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.