Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.800 1.7e-04
diabetes mellitus 1.300 2.2e-03
inflammatory breast cancer -1.300 4.3e-05
intraductal papillary-mucinous adenoma (... -2.100 1.3e-03
intraductal papillary-mucinous carcinoma... -1.500 2.4e-02
nephrosclerosis -1.361 1.9e-02
pancreatic cancer -1.300 9.6e-03
primary pancreatic ductal adenocarcinoma -1.340 6.7e-03

Gene RIF (3)

AA Sequence

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLL      1 - 70
LCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGED     71 - 140
GQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSS    141 - 210
RTLFCREQKHSHISSIA                                                         211 - 227
//

Text Mined References (10)

PMID Year Title