Property Summary

NCBI Gene PubMed Count 14
PubMed Score 40.52
PubTator Score 3.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
Pick disease 1894 1.7e-05
ovarian cancer 8520 2.1e-05
psoriasis 6694 9.1e-05
osteosarcoma 7950 1.6e-04
group 3 medulloblastoma 4104 1.6e-03
Multiple myeloma 1332 1.5e-02
Disease Target Count Z-score Confidence
Cataract 7 32 3.922 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-03
Multiple myeloma 1.009 1.5e-02
osteosarcoma -1.339 1.6e-04
ovarian cancer 1.300 2.1e-05
Pick disease -1.400 1.7e-05
psoriasis 1.800 9.1e-05

Gene RIF (2)

AA Sequence

MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEGAAKIAFPSAN      1 - 70
EVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLSEQEEEKVELKESENLASGDQ     71 - 140
PRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRSVVANDASTRAVDLIRRNVQLNDVAHLVQPSQ    141 - 210
ADARMLMYQHQRVSERFDVIDLDPYGSPATFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAM    211 - 280
ALKSRACHEMALRIVLHSLDLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVG    281 - 350
CGAFHLQRLGKASGVPSGRAKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPG    351 - 420
RFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDA    421 - 490
PASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWG    491 - 560
PRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPR    561 - 630
VSADAAPDCPETSNQTPPGPGAAAGPGID                                             631 - 659
//

Text Mined References (19)

PMID Year Title