Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.32
PubTator Score 6.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q9NXF8 D3DUM1 Q8WV42 Q9NVD8
Symbols DHHC7
SERZ1
SERZ-B
ZNF370

Gene

Gene RIF (2)

PMID Text
25301068 DHHC7-mediated palmitoylation of Fas allows a proper Fas expression level by preventing its degradation through the lysosomes.
22031296 the DHHC-7 and -21 proteins are novel targets to selectively inhibit membrane sex steroid receptor localization and function

AA Sequence

MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVML      1 - 70
LPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKP     71 - 140
ERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSD    141 - 210
FSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPS    211 - 280
LLWMNPFVGFRFRRLPTRPRKGGPEFSV                                              281 - 308
//

Text Mined References (13)

PMID Year Title
25301068 2015 Fas palmitoylation by the palmitoyl acyltransferase DHHC7 regulates Fas stability.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22031296 2012 DHHC-7 and -21 are palmitoylacyltransferases for sex steroid receptors.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...