Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.69
PubTator Score 6.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 3.2e-03
intraductal papillary-mucinous adenoma (... 1.500 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.400 6.1e-03
osteosarcoma -2.121 1.2e-07
ovarian cancer 1.100 1.3e-03

Gene RIF (4)

AA Sequence

MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVML      1 - 70
LPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKP     71 - 140
ERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSD    141 - 210
FSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPS    211 - 280
LLWMNPFVGFRFRRLPTRPRKGGPEFSV                                              281 - 308
//

Text Mined References (15)

PMID Year Title