Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Schizoaffective Disorder 55 3.074 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.424 4.2e-06
dermatomyositis 1.100 1.9e-03
glioblastoma 1.700 2.5e-03
lung cancer 1.100 5.4e-03
Multiple myeloma 1.270 1.4e-03
ovarian cancer -1.400 4.2e-07
pituitary cancer 1.200 6.8e-04
Waldenstrons macroglobulinemia 1.010 4.3e-03

AA Sequence

MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYL      1 - 70
NYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADF     71 - 140
SVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAI    141 - 210
FDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRT    211 - 280
GLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDF    281 - 350
TVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNED    351 - 420
PQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEER    421 - 490
ILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMA    491 - 560
LSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLN    561 - 630
RYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENY    631 - 700
RNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKS    701 - 770
KVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHML    771 - 840
SWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP                                       841 - 875
//

Text Mined References (25)

PMID Year Title