Property Summary

NCBI Gene PubMed Count 29
PubMed Score 91.83
PubTator Score 32.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease -1.200 3.4e-02
Astrocytoma, Pilocytic -1.600 9.3e-05
atypical teratoid / rhabdoid tumor 1.400 3.0e-02
cystic fibrosis -2.942 9.6e-06
ependymoma -2.100 2.1e-02
group 3 medulloblastoma 1.500 1.3e-04
lung carcinoma 3.700 1.3e-41
malignant mesothelioma 1.800 7.2e-06
medulloblastoma, large-cell 2.500 1.1e-05
Pick disease -1.300 4.1e-04
pituitary cancer 2.200 5.3e-04
progressive supranuclear palsy -1.100 2.1e-02

Gene RIF (14)

AA Sequence

MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL      1 - 70
YNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS     71 - 140
QITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL    141 - 210
VQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFS    211 - 280
KAYFTAANGVMNKKAQ                                                          281 - 296
//

Text Mined References (31)

PMID Year Title