Property Summary

NCBI Gene PubMed Count 26
PubMed Score 85.23
PubTator Score 32.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Male infertility 170
Disease Target Count P-value
lung carcinoma 2844 1.33034571889349E-41
malignant mesothelioma 3163 7.22658739172514E-6
cystic fibrosis 1670 9.64737613813307E-6
medulloblastoma, large-cell 6234 1.09266008962657E-5
group 4 medulloblastoma 1875 9.06837374527541E-5
pilocytic astrocytoma 3086 1.13237662131111E-4
Pick disease 1893 4.05615606531747E-4
pituitary cancer 1972 5.25838086579859E-4
ependymoma 2514 0.0212767570692942
progressive supranuclear palsy 674 0.0214714075126804
atypical teratoid / rhabdoid tumor 4369 0.0299986517846227
Alzheimer's disease 644 0.0338343351160985
Disease Target Count Z-score Confidence
Umbilical hernia 18 3.787 1.9
Gastric antral vascular ectasia 11 3.487 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
ependymoma -2.100 0.021
group 4 medulloblastoma 2.300 0.000
cystic fibrosis -2.942 0.000
atypical teratoid / rhabdoid tumor 1.400 0.030
medulloblastoma, large-cell 2.500 0.000
pilocytic astrocytoma -1.600 0.000
lung carcinoma 3.700 0.000
Alzheimer's disease -1.200 0.034
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.021
pituitary cancer 2.200 0.001

Synonym

Accession Q9NXB9 Q6P9E1 Q86W94
Symbols SSC2

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
26633493 Polymorphisms in the ELOVL2 gene were not associated with the risk of developing allergic disease
25450787 results show that the ELOVL2 locus provides a very good source of information about human chronological age based on analysis of blood, including bloodstains, and it may constitute a powerful and reliable predictor in future forensic age estimation models
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of ELOVL fatty acid elongase 2 (ELOVL2) in primary human brain microvascular endothelial cells
23555103 we do not found the association between rs3756593 of ELOVL2 gene and acute coronary syndrome in Chinese Han population
23061750 Methylation of ELOVL2 gene is a new epigenetic marker of age.
21917437 gene interaction analysis showed that the combined genotype of FADS1 rs174556 (T/T) and ELOVL2 rs3756963 (T/T) was weakly associated with coronary artery disease
21560298 rs3756963 in ELOVL2 gene may be associated with paranoid schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20037589 Observational study of gene-disease association. (HuGE Navigator)
19148276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL      1 - 70
YNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS     71 - 140
QITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL    141 - 210
VQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFS    211 - 280
KAYFTAANGVMNKKAQ                                                          281 - 296
//

Text Mined References (28)

PMID Year Title
26633493 2015 Single Nucleotide Polymorphisms in the FADS Gene Cluster but not the ELOVL2 Gene are Associated with Serum Polyunsaturated Fatty Acid Composition and Development of Allergy (in a Swedish Birth Cohort).
25450787 2015 Examination of DNA methylation status of the ELOVL2 marker may be useful for human age prediction in forensic science.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23555103 2013 A case-control study between gene polymorphisms of polyunsaturated fatty acid metabolic rate-limiting enzymes and acute coronary syndrome in Chinese Han population.
23061750 2012 Methylation of ELOVL2 gene as a new epigenetic marker of age.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21917437 2011 A case-control study between the gene polymorphisms of polyunsaturated fatty acids metabolic rate-limiting enzymes and coronary artery disease in a Chinese Han population.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
More...