Property Summary

NCBI Gene PubMed Count 40
Grant Count 46
R01 Count 29
Funding $4,952,016.35
PubMed Score 198.82
PubTator Score 53.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.015
osteosarcoma -3.580 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.200 0.002
lung cancer 1.200 0.004
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.100 0.001

Gene RIF (25)

PMID Text
27023330 mutual cooperation between Y102 and R105 residues in promoting the desuccinylation versus deacetylation reaction in SIRT5.
26001219 Use of a pan-sirtuin inhibitor and shRNA-mediated protein knockdown led us to uncover a role for the NAD(+)-dependent family of sirtuins, and in particular for SIRT2 and SIRT5, in the regulation of the necroptotic cell death program
25717114 Data showed that SIRT5 was involved in protein post-translational modifications through its potent demalonylase, desuccinylase, and deglutarylase activities. Also, the protein was found in the mitochondrial, cytoplasmic, and nuclear compartments. [review]
25361925 This study demonstrated that SIRT15 downregulation in the liver of non-alcoholic fatty liver disease patients.
25165814 Results show that mitochondrial sirtuins SIRT3, SIRT4, and SIRT5 can promote increased mitochondrial respiration and cellular metabolism and respond to excess glucose by inducing a coordinated increase of glycolysis and respiration.
25111069 The results reveal the Sirt5 substrate acyl selectivity and its molecular basis and enable the design of inhibitors for Sirt5.
25070488 High SIRT5 expression facilitates cancer cell growth and drug resistance in non-small cell lung cancer.
25032863 SIRT1/SIRT5-mediated PML deacetylation plays a role in the regulation of cancer cell survival.
24464653 Expression of SIRT5 in the entorhinal cortex, hippocampus, and white matter increases during the progression of Alzheimer disease. It is seen in activated microglia.
24140062 These results reveal a novel post-translational regulation of SOD1 by means of succinylation and SIRT5-dependent desuccinylation, which is important for the growth of lung tumor cells.
More...

AA Sequence

MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF      1 - 70
RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQ     71 - 140
NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA    141 - 210
GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP    211 - 280
ATNRFRFHFQGPCGTTLPEALACHENETVS                                            281 - 310
//

Text Mined References (46)

PMID Year Title
27023330 2016 Role of the Substrate Specificity-Defining Residues of Human SIRT5 in Modulating the Structural Stability and Inhibitory Features of the Enzyme.
26001219 2016 Intracellular nicotinamide adenine dinucleotide promotes TNF-induced necroptosis in a sirtuin-dependent manner.
25717114 2015 Metabolic Regulation by Lysine Malonylation, Succinylation, and Glutarylation.
25361925 2014 Direct evidence of sirtuin downregulation in the liver of non-alcoholic fatty liver disease patients.
25165814 2014 Overexpression of mitochondrial sirtuins alters glycolysis and mitochondrial function in HEK293 cells.
25111069 2014 Chemical probing of the human sirtuin 5 active site reveals its substrate acyl specificity and peptide-based inhibitors.
25070488 2014 SIRT5 facilitates cancer cell growth and drug resistance in non-small cell lung cancer.
25032863 2014 Deacetylation of the tumor suppressor protein PML regulates hydrogen peroxide-induced cell death.
24703693 2014 Lysine glutarylation is a protein posttranslational modification regulated by SIRT5.
24464653 2014 Distinct patterns of sirtuin expression during progression of Alzheimer's disease.
More...