Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.33
PubTator Score 9.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 2.42715204294191E-10
lung adenocarcinoma 2714 1.19402527085351E-9
psoriasis 6685 2.98600802642412E-8
malignant mesothelioma 3163 3.80309294337127E-8
ependymoma 2514 7.89788950199008E-8
non-small cell lung cancer 2798 6.3592412446986E-7
pilocytic astrocytoma 3086 2.08975281001389E-6
Breast cancer 3099 4.81332177635946E-6
medulloblastoma, large-cell 6234 1.40919259651031E-5
pediatric high grade glioma 2712 2.42361595566154E-5
ovarian cancer 8492 5.55054975812176E-5
nasopharyngeal carcinoma 1056 7.09717343996384E-5
atypical teratoid / rhabdoid tumor 4369 9.36060124307884E-5
glioblastoma 5572 1.3160014529241E-4
primary pancreatic ductal adenocarcinoma 1271 2.40383714271728E-4
Atopic dermatitis 944 5.69625370696835E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00199302489805702
pancreatic cancer 2300 0.0042242064130537
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00457942738465362
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00774647686749104
chronic rhinosinusitis 512 0.0115452744233874
primitive neuroectodermal tumor 3031 0.01721116305785
subependymal giant cell astrocytoma 2287 0.02175180169982
X-linked cerebral adrenoleukodystrophy 115 0.0354589445415798
cystic fibrosis and chronic rhinosinusitis 213 0.046389173022158

Expression

Synonym

Accession Q9NX95 A8K354 B3KQX3 B3KU61 Q5R1T1 Q5R1T2 Q5R1T3 Q5Y2M6 Q8ND49 Q8TCR6 Q96D80 Q9P256
Symbols OCSYN
SNPHL
GOLSYN

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (3)

PMID Text
22975310 syntabulin could be a novel effector of Epac2 and play a critical role in cAMP-enhanced insulin secretion
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16750881 Functional characterization of the mouse Golsyn/Syntabulin ortholog.

AA Sequence

MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPSSSGRSARTVS      1 - 70
SNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGMVGEGSIQSSRYKKESKSGLV     71 - 140
KPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGPHGRSNGASSHKPGSSPSSPREKDLLSMLCR    141 - 210
NQLSPVNIHPSYAPSSPSSSNSGSYKGSDCSPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRH    211 - 280
LKTKLKESERRLHERESEIVELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLAD    281 - 350
KDKGIQKYFVDINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV    351 - 420
TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEGSVVVERAVQT    421 - 490
DVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAILLSPVETP    491 - 560
YANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVRQYWSSSFLVDLLAVAAPVVPTVLWAFSTQR    561 - 630
GGTDPVYNIGALLRGCCVVALHSLRRTAFRIKT                                         631 - 663
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975310 2012 The microtubule associated protein syntabulin is required for glucose-stimulated and cAMP-potentiated insulin secretion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17611281 2007 Syntabulin-kinesin-1 family member 5B-mediated axonal transport contributes to activity-dependent presynaptic assembly.
16750881 2006 Expression of m-Golsyn/Syntabulin gene during mouse brain development.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16157705 2005 Syntabulin-mediated anterograde transport of mitochondria along neuronal processes.
More...