Property Summary

NCBI Gene PubMed Count 14
Grant Count 22
R01 Count 11
Funding $3,851,121.77
PubMed Score 12.33
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
22975310 syntabulin could be a novel effector of Epac2 and play a critical role in cAMP-enhanced insulin secretion
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16750881 Functional characterization of the mouse Golsyn/Syntabulin ortholog.

AA Sequence

MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPSSSGRSARTVS      1 - 70
SNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGMVGEGSIQSSRYKKESKSGLV     71 - 140
KPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGPHGRSNGASSHKPGSSPSSPREKDLLSMLCR    141 - 210
NQLSPVNIHPSYAPSSPSSSNSGSYKGSDCSPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRH    211 - 280
LKTKLKESERRLHERESEIVELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLAD    281 - 350
KDKGIQKYFVDINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV    351 - 420
TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEGSVVVERAVQT    421 - 490
DVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAILLSPVETP    491 - 560
YANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVRQYWSSSFLVDLLAVAAPVVPTVLWAFSTQR    561 - 630
GGTDPVYNIGALLRGCCVVALHSLRRTAFRIKT                                         631 - 663
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975310 2012 The microtubule associated protein syntabulin is required for glucose-stimulated and cAMP-potentiated insulin secretion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17611281 2007 Syntabulin-kinesin-1 family member 5B-mediated axonal transport contributes to activity-dependent presynaptic assembly.
16750881 2006 Expression of m-Golsyn/Syntabulin gene during mouse brain development.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16157705 2005 Syntabulin-mediated anterograde transport of mitochondria along neuronal processes.
More...