Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.60
PubTator Score 2.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.23379909414033E-9
osteosarcoma 7933 1.19759387245499E-5
pituitary cancer 1972 6.88558820533473E-5
psoriasis 6685 8.21793258194735E-5
diabetes mellitus 1663 0.00216406198614942
medulloblastoma, large-cell 6234 0.00293378796914203
primary pancreatic ductal adenocarcinoma 1271 0.00412721292135905
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00792084545430954
pancreatic cancer 2300 0.00797355330408835

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma -2.020 0.000
medulloblastoma, large-cell -1.200 0.003
primary pancreatic ductal adenocarcinoma 1.278 0.004
intraductal papillary-mucinous adenoma (... 1.100 0.008
diabetes mellitus -1.200 0.002
ovarian cancer -1.700 0.000
pituitary cancer -1.100 0.000
pancreatic cancer 1.400 0.008

Synonym

Accession Q9NX94 B3KPF4 B7Z6S7 D3DR90 Q1EG70 Q2HIY7 Q5F2G6
Symbols OPA1L
OPAL1
C10orf26

Gene

  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
16709928 OPAL1 expression may not be an independent prognostic feature in childhood ALL, and its previously reported prognostic impact appears to be treatment dependent.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCVCHHRRAKHRL      1 - 70
QAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPPPYSAFQLQQQQLLPPQCGPA     71 - 140
GGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGA    141 - 210
FLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGP    211 - 280
LDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS            281 - 342
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22120523 2012 Unexpected diversity in Shisa-like proteins suggests the importance of their roles as transmembrane adaptors.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16709928 2006 Expression of the outcome predictor in acute leukemia 1 (OPAL1) gene is not an independent prognostic factor in patients treated according to COALL or St Jude protocols.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...