Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.79
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
diabetes mellitus -1.200 2.2e-03
intraductal papillary-mucinous adenoma (... 1.100 7.9e-03
medulloblastoma, large-cell -1.200 2.9e-03
osteosarcoma -2.020 1.2e-05
ovarian cancer -1.700 5.2e-09
pancreatic cancer 1.400 8.0e-03
pituitary cancer -1.100 6.9e-05
primary pancreatic ductal adenocarcinoma 1.278 4.1e-03
psoriasis -1.800 8.2e-05

Gene RIF (2)

AA Sequence

MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCVCHHRRAKHRL      1 - 70
QAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPPPYSAFQLQQQQLLPPQCGPA     71 - 140
GGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGA    141 - 210
FLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGP    211 - 280
LDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS            281 - 342
//

Text Mined References (17)

PMID Year Title