Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.80
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GO Function (1)

Gene RIF (3)

AA Sequence

MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF      1 - 70
FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF     71 - 140
GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA                               141 - 183
//

Text Mined References (15)

PMID Year Title