Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.95
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.13859098064916E-14
juvenile dermatomyositis 1189 6.11577372300448E-11
pediatric high grade glioma 2712 3.07252807688766E-8
pilocytic astrocytoma 3086 6.11375654851099E-8
Duchenne muscular dystrophy 602 1.39323762907371E-7
atypical teratoid / rhabdoid tumor 4369 2.51699461225496E-6
glioblastoma 5572 1.99020661868939E-5
osteosarcoma 7933 1.12070682016893E-4
Pick disease 1893 5.84965079966576E-4
ovarian cancer 8492 6.32888284818997E-4
acute quadriplegic myopathy 1157 7.744920834668E-4
dermatomyositis 967 0.00135001009737695
pancreatic cancer 2300 0.00165806168174988
astrocytoma 1493 0.00355839984593243
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00392448022081845
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00400968121117814
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00866158843660449
diabetes mellitus 1663 0.0138835214839193
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0237396969353785
Breast cancer 3099 0.0270162221104319
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0281776535927842

Expression

Synonym

Accession Q9NX76 Q6IAC4
Symbols CKLFSF6
PRO2219

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF      1 - 70
FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF     71 - 140
GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA                               141 - 183
//

Text Mined References (13)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...