Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.97
PubTator Score 4.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.067 5.7e-04
Breast cancer 4.300 2.4e-02
diabetes mellitus -1.400 1.3e-03
gastric carcinoma 1.200 3.7e-02
glioblastoma 1.300 2.6e-06
non primary Sjogren syndrome sicca 1.400 1.2e-02
non-small cell lung cancer 1.061 6.5e-16
osteosarcoma 2.183 1.4e-04
ovarian cancer 2.100 7.8e-04
pancreatic ductal adenocarcinoma liver m... -1.403 5.3e-03
pediatric high grade glioma 1.100 1.6e-07
Pick disease -1.200 9.2e-04

Gene RIF (2)

AA Sequence

MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGTVDLREMLAVS      1 - 70
VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAAD     71 - 140
QEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP    141 - 210
FSEYTAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVP    211 - 280
DKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKL    281 - 350
PDLEKTGHK                                                                 351 - 359
//

Text Mined References (13)

PMID Year Title