Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.97
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 4.79354391333832E-15
pediatric high grade glioma 2712 1.56370161187836E-7
glioblastoma 5572 2.62252850493481E-6
acute quadriplegic myopathy 1157 3.06039812631914E-6
osteosarcoma 7933 1.42768117074595E-4
ovarian cancer 8492 7.80579164903125E-4
Pick disease 1893 9.24067293276891E-4
diabetes mellitus 1663 0.00128678113074482
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00166797322709635
non primary Sjogren syndrome sicca 840 0.0122660998261158
Breast cancer 3099 0.0238523710285762
gastric carcinoma 832 0.0365397996952767
Disease Target Count Z-score Confidence
Desbuquois dysplasia 9 5.205 2.6
Brachydactyly 52 4.466 2.2
Cleft palate 125 3.548 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 2.183 0.000
glioblastoma 1.300 0.000
acute quadriplegic myopathy 1.864 0.000
pancreatic ductal adenocarcinoma liver m... -2.061 0.002
non-small cell lung cancer 1.158 0.000
diabetes mellitus -1.400 0.001
Breast cancer 4.300 0.024
pediatric high grade glioma 1.100 0.000
non primary Sjogren syndrome sicca 1.400 0.012
Pick disease -1.200 0.001
gastric carcinoma 1.200 0.037
ovarian cancer 2.100 0.001

Synonym

Accession Q9NX62 Q6NVY7 IMP 3
Symbols GPAPP
IMP 3
IMP-3
IMPA3

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

 IMPC Term (1)

Gene RIF (2)

PMID Text
22887726 concluded that IMPAD1 should be screened for patients with Catel-Manzke and additional features
21549340 Affected individuals carried homozygous missense mutations in IMPAD1, the gene coding for gPAPP, a Golgi-resident nucleotide phosphatase that hydrolyzes phosphoadenosine phosphate (PAP), the byproduct of sulfotransferase reactions, to AMP.

AA Sequence

MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGTVDLREMLAVS      1 - 70
VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAAD     71 - 140
QEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP    141 - 210
FSEYTAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVP    211 - 280
DKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKL    281 - 350
PDLEKTGHK                                                                 351 - 359
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22887726 2012 IMPAD1 mutations in two Catel-Manzke like patients.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21549340 2011 Chondrodysplasia and abnormal joint development associated with mutations in IMPAD1, encoding the Golgi-resident nucleotide phosphatase, gPAPP.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18695242 2008 A role for a lithium-inhibited Golgi nucleotidase in skeletal development and sulfation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...