Property Summary

NCBI Gene PubMed Count 23
PubMed Score 19.28
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric carcinoma 1.100 8.0e-03
group 3 medulloblastoma 1.300 1.2e-02
lung carcinoma -1.100 3.0e-16
medulloblastoma, large-cell 1.400 3.2e-03
non primary Sjogren syndrome sicca 1.200 1.6e-02
ovarian cancer 1.700 9.9e-05
ulcerative colitis 1.100 3.5e-06

Gene RIF (4)

AA Sequence

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKG      1 - 70
DIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEA     71 - 140
SNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLEN    141 - 210
HQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVET    211 - 280
DSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRS    281 - 350
EEELLVIFNKKISKNPTFKLLKDKVKLVK                                             351 - 379
//

Text Mined References (28)

PMID Year Title