Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.99
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.003
group 3 medulloblastoma 1.300 0.012
non primary Sjogren syndrome sicca 1.200 0.016
lung carcinoma -1.100 0.000
gastric carcinoma 1.100 0.008
ulcerative colitis 1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9NX58 D3DVS4 Q6FI78 Q9NYS1
Symbols ZLYAR
ZC2HC2

Gene

Gene RIF (4)

PMID Text
26413750 LYAR may promote tumor cell migration and invasion by upregulating galectin-1 gene expression in colorectal cancer.
25092918 The data indicate that LYAR acts as a novel transcription factor that binds the gamma-globin gene, and is essential for silencing the gamma-globin gene.
24990247 Results show that LYAR protein expression is testis-predominant but can also be found in cancer cells originated from tissues other than testis. Lyar seems to promote proliferation of NIH-3T3 cells.
24495227 Over-expression of LYAR increases cell proliferation without affecting the expression of c-Myc or p53. Some rapidly growing cells enhance ribosome biogenesis by increasing the expression of LYAR.

AA Sequence

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKG      1 - 70
DIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEA     71 - 140
SNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLEN    141 - 210
HQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVET    211 - 280
DSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRS    281 - 350
EEELLVIFNKKISKNPTFKLLKDKVKLVK                                             351 - 379
//

Text Mined References (27)

PMID Year Title
26413750 2015 LYAR promotes colorectal cancer cell mobility by activating galectin-1 expression.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25092918 2014 Human fetal globin gene expression is regulated by LYAR.
24990247 2014 Lyar, a cell growth-regulating zinc finger protein, was identified to be associated with cytoplasmic ribosomes in male germ and cancer cells.
24495227 2014 Human cell growth regulator Ly-1 antibody reactive homologue accelerates processing of preribosomal RNA.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...