Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.36
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.29293386851825E-10
malignant mesothelioma 3163 5.36143048446217E-8
pituitary cancer 1972 5.48555755996012E-7
lung cancer 4473 4.52509750396958E-5
hepatocellular carcinoma 550 1.70512616911454E-4
ovarian cancer 8492 2.18823148103089E-4
adrenocortical carcinoma 1427 4.18279035470464E-4
invasive ductal carcinoma 2950 0.00594070799840469
cutaneous lupus erythematosus 1056 0.00883876124798534
adult high grade glioma 2148 0.00893313859603198
glioblastoma 5572 0.0121141542380643
colon cancer 1475 0.0133215701471067
esophageal adenocarcinoma 737 0.0176010007179145
Disease Target Count Z-score Confidence
Hemophagocytic lymphohistiocytosis 30 3.192 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
malignant mesothelioma 3.100 0.000
esophageal adenocarcinoma 1.600 0.018
cutaneous lupus erythematosus 1.300 0.009
glioblastoma 1.700 0.012
adrenocortical carcinoma -1.821 0.000
non-small cell lung cancer -1.102 0.000
lung cancer -2.600 0.000
colon cancer 1.100 0.013
adult high grade glioma 1.100 0.009
invasive ductal carcinoma 1.020 0.006
ovarian cancer 1.300 0.000
pituitary cancer -1.800 0.000

Synonym

Accession Q9NX57 Q5T9X5 Q9NX49
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (3)

PMID Text
23874396 TdIF1 associates with the RAB20 promoter, and RAB20 gene transcription is reduced in TdIF1-knocked-down cells, suggesting that TdIF1 stimulates RAB20 gene transcription.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649179 Regulates connexin 43 intracellular transport.

AA Sequence

MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYC      1 - 70
RGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDR     71 - 140
VSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRA    141 - 210
ERPSHTVDISSHKPPKRTRSGCCA                                                  211 - 234
//

Text Mined References (11)

PMID Year Title
23874396 2013 TdIF1 recognizes a specific DNA sequence through its Helix-Turn-Helix and AT-hook motifs to regulate gene transcription.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18649179 2008 Identification of rab20 as a potential regulator of connexin 43 trafficking.
16613320 2006 Characterization of human Rab20 overexpressed in exocrine pancreatic carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.
More...