Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.54
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.821 4.2e-04
adult high grade glioma 1.100 8.9e-03
colon cancer 1.100 1.3e-02
cutaneous lupus erythematosus 1.300 8.8e-03
esophageal adenocarcinoma 1.600 1.8e-02
glioblastoma 1.700 1.2e-02
hepatocellular carcinoma -1.100 1.7e-04
invasive ductal carcinoma 1.020 5.9e-03
lung cancer -1.300 2.5e-03
malignant mesothelioma 3.100 5.4e-08
non-small cell lung cancer -1.102 1.3e-10
ovarian cancer 1.300 2.2e-04
pituitary cancer -1.800 5.5e-07

Gene RIF (4)

AA Sequence

MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYC      1 - 70
RGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDR     71 - 140
VSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRA    141 - 210
ERPSHTVDISSHKPPKRTRSGCCA                                                  211 - 234
//

Text Mined References (12)

PMID Year Title