Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.36
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
malignant mesothelioma 3.100 0.000
esophageal adenocarcinoma 1.600 0.018
cutaneous lupus erythematosus 1.300 0.009
glioblastoma 1.700 0.012
adrenocortical carcinoma -1.821 0.000
non-small cell lung cancer -1.102 0.000
lung cancer -2.600 0.000
colon cancer 1.100 0.013
adult high grade glioma 1.100 0.009
invasive ductal carcinoma 1.020 0.006
ovarian cancer 1.300 0.000
pituitary cancer -1.800 0.000

Synonym

Accession Q9NX57 Q5T9X5 Q9NX49
Symbols

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
23874396 TdIF1 associates with the RAB20 promoter, and RAB20 gene transcription is reduced in TdIF1-knocked-down cells, suggesting that TdIF1 stimulates RAB20 gene transcription.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649179 Regulates connexin 43 intracellular transport.

AA Sequence

MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYC      1 - 70
RGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDR     71 - 140
VSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRA    141 - 210
ERPSHTVDISSHKPPKRTRSGCCA                                                  211 - 234
//

Text Mined References (11)

PMID Year Title
23874396 2013 TdIF1 recognizes a specific DNA sequence through its Helix-Turn-Helix and AT-hook motifs to regulate gene transcription.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18649179 2008 Identification of rab20 as a potential regulator of connexin 43 trafficking.
16613320 2006 Characterization of human Rab20 overexpressed in exocrine pancreatic carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.
More...